NEK9 Antibody (1F6)

Images

 
Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of monoclonal antibody to NEK9 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6 Analysis of NEK9 expression in HeLa.
Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in PC-12.
Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in Raw 264.7.
Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.Lane 1: NEK9 transfected lysate(107.2 KDa).Lane 2: ...read more
Sandwich ELISA: NEK9 Antibody (1F6) [H00091754-M01] - Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NEK9 Antibody (1F6) Summary

Immunogen
NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL
Specificity
NEK9 - NIMA (never in mitosis gene a)- related kinase 9
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEK9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publication using H00091754-M01.

Reactivity Notes

Human, Mouse, Rat. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEK9 Antibody (1F6)

  • DKFZp434D0935
  • KIAA1995
  • MGC138306
  • MGC16714
  • NEK8
  • Nek8NERCC1
  • Nercc1 kinase
  • NERCCEC 2.7.11.1
  • Never in mitosis A-related kinase 9
  • NIMA (never in mitosis gene a)- related kinase 9
  • NimA-related kinase 8
  • NIMA-related kinase Nek8
  • NimA-related protein kinase 9
  • serine/threonine-protein kinase Nek9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47865
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80470
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00004751-M11
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP1-85637
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
H00027130-P02
Species: Hu
Applications: ELISA, AP, PA, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-13650
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP3-17404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00121441-M05
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ELISA, IB, ICC/IF, IHC, IHC-P, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for NEK9 Antibody (H00091754-M01)(1)


Reviews for NEK9 Antibody (H00091754-M01) (0)

There are no reviews for NEK9 Antibody (H00091754-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK9 Antibody (H00091754-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK9 Products

Bioinformatics Tool for NEK9 Antibody (H00091754-M01)

Discover related pathways, diseases and genes to NEK9 Antibody (H00091754-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK9 Antibody (H00091754-M01)

Discover more about diseases related to NEK9 Antibody (H00091754-M01).
 

Pathways for NEK9 Antibody (H00091754-M01)

View related products by pathway.

PTMs for NEK9 Antibody (H00091754-M01)

Learn more about PTMs related to NEK9 Antibody (H00091754-M01).
 

Research Areas for NEK9 Antibody (H00091754-M01)

Find related products by research area.

Blogs on NEK9

There are no specific blogs for NEK9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK9 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK9
Entrez
OMIM
Uniprot