NEK2 Antibody (3B7)

Images

 
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/ Immunofluorescence: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of monoclonal antibody to NEK2 on HeLa cell. Antibody concentration 25 ug/ml
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in PC-12 (Cat # L012V1).
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: NEK2 Antibody (3B7) [H00004751-M11] - Analysis of NEK2 expression in NIH/3T3 (Cat # L018V1).
ELISA: NEK2 Antibody (3B7) [H00004751-M11] - Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NEK2 Antibody (3B7) Summary

Immunogen
NEK2 (AAH43502, 331 a.a. - 445 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Specificity
NEK2 (3B7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEK2 Antibody (3B7)

  • EC 2.7.11
  • EC 2.7.11.1
  • HSPK 21
  • HsPK21
  • NEK2
  • NEK2AHsPK21
  • Never in mitosis A-related kinase 2
  • NIMA (never in mitosis gene a)-related kinase 2
  • NimA-like protein kinase 1
  • NimA-related protein kinase 2
  • NLK1
  • NLK1serine/threonine-protein kinase Nek2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-57371
Species: Hu
Applications: ICC/IF
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-80820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for NEK2 Antibody (H00004751-M11) (0)

There are no publications for NEK2 Antibody (H00004751-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK2 Antibody (H00004751-M11) (0)

There are no reviews for NEK2 Antibody (H00004751-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK2 Antibody (H00004751-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK2 Products

Bioinformatics Tool for NEK2 Antibody (H00004751-M11)

Discover related pathways, diseases and genes to NEK2 Antibody (H00004751-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK2 Antibody (H00004751-M11)

Discover more about diseases related to NEK2 Antibody (H00004751-M11).
 

Pathways for NEK2 Antibody (H00004751-M11)

View related products by pathway.

PTMs for NEK2 Antibody (H00004751-M11)

Learn more about PTMs related to NEK2 Antibody (H00004751-M11).
 

Research Areas for NEK2 Antibody (H00004751-M11)

Find related products by research area.

Blogs on NEK2

There are no specific blogs for NEK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK2 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK2
Entrez
OMIM
Uniprot