beta II Tubulin B Antibody - BSA Free

Western Blot: beta II Tubulin B Antibody [NBP2-88773] - WB Suggested Anti-TUBB2B Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell

Western Blot: beta II Tubulin B Antibody [NBP2-88773] - Host: Rabbit. Target Name: TUBB2B. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

beta II Tubulin B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit beta II Tubulin B Antibody - BSA Free (NBP2-88773) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human beta II Tubulin B. Peptide sequence: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUBB2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for beta II Tubulin B Antibody - BSA Free

• bA506K6.1
• beta II Tubulin B
• class II beta-tubulin isotype
• DKFZp566F223
• FLJ98847
• MGC8685
• TUBB2B
• tubulin beta-2B chain
• tubulin, beta 2B
• tubulin, beta polypeptide paralog

Background

Tubulin is the major constituent of microtubules. It exists as a heterodimer consiting of an alpha and a beta subunit. Class II beta tubulin is the major form of tubulin beta in neurons, although it is not neuronal specific. It is found in many other tissues including lung tissue and Schwann cells. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a nonexchangeable site on the alpha chain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUBB2B