MAP4 Antibody


Western Blot: MAP4 Antibody [NBP1-89483] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunocytochemistry/ Immunofluorescence: MAP4 Antibody [NBP1-89483] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & microtubules.
Immunohistochemistry-Paraffin: MAP4 Antibody [NBP1-89483] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: MAP4 Antibody [NBP1-89483] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MAP4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT
Microtubule Marker
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP4 Protein (NBP1-89483PEP)
Read Publication using NBP1-89483.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MAP4 Antibody

  • DKFZp779A1753
  • MAP-4
  • MGC8617
  • microtubule-associated protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MAP4 Antibody (NBP1-89483)(1)

Reviews for MAP4 Antibody (NBP1-89483) (0)

There are no reviews for MAP4 Antibody (NBP1-89483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAP4 Antibody (NBP1-89483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MAP4 Products

Bioinformatics Tool for MAP4 Antibody (NBP1-89483)

Discover related pathways, diseases and genes to MAP4 Antibody (NBP1-89483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4 Antibody (NBP1-89483)

Discover more about diseases related to MAP4 Antibody (NBP1-89483).

Pathways for MAP4 Antibody (NBP1-89483)

View related products by pathway.

PTMs for MAP4 Antibody (NBP1-89483)

Learn more about PTMs related to MAP4 Antibody (NBP1-89483).

Research Areas for MAP4 Antibody (NBP1-89483)

Find related products by research area.

Blogs on MAP4

There are no specific blogs for MAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAP4 Antibody and receive a gift card or discount.


Gene Symbol MAP4