non-muscle Myosin IIA Antibody (2B3)

Images

 
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3. Lane 1: MYH9 transfected lysate (Predicted MW: ...read more
Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Bovine ovarian granulosa cells. Anti Myosin IIA immunofluorescent staining (green). DNA in counterstained with DAPI (blue). ...read more
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 0.5 ug/ml
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in HeLa.
Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in human kidney.
Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

non-muscle Myosin IIA Antibody (2B3) Summary

Immunogen
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Specificity
MYH9 (2B3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYH9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 5
using
H00004627-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for non-muscle Myosin IIA Antibody (2B3)

  • Cellular myosin heavy chain, type A
  • DFNA17
  • EPSTS
  • FTNSNMMHC-IIA
  • MGC104539
  • MHANMMHC II-a
  • MYH9 variant protein
  • MYH9
  • Myosin heavy chain 9
  • Myosin heavy chain, non-muscle IIa
  • myosin, heavy chain 9, non-muscle
  • myosin, heavy polypeptide 9, non-muscle
  • myosin-9
  • NMHC-II-A
  • NMMHC II-a
  • NMMHCA
  • NMMHC-A
  • NMMHC-IIA
  • Non-muscle myosin heavy chain A
  • Non-muscle myosin heavy chain IIa
  • nonmuscle myosin heavy chain II-A
  • non-muscle myosin heavy polypeptide 9
  • Non-muscle Myosin IIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-94624
Species: Hu, Mu, Rt
Applications: IHC, WB
NB110-95574
Species: Bv, Hu, Mu, Pm, Rt(-)
Applications: ICC/IF, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-38986
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-13591
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3159
Species: Mu
Applications: IHC
MAB5175
Species: Mu
Applications: IHC, WB

Publications for non-muscle Myosin IIA Antibody (H00004627-M03) (0)

There are no publications for non-muscle Myosin IIA Antibody (H00004627-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for non-muscle Myosin IIA Antibody (H00004627-M03) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Bovine.

Reviews using H00004627-M03:
Filter by Applications
immunofluorescence on in vitro grown cells
(1)
All Applications
Filter by Species
Bovine
(1)
All Species
Images Ratings Applications Species Date Details
Other non-muscle Myosin IIA H00004627-M03
Enlarge
5
reviewed by:
Verified Customer
immunofluorescence on in vitro grown cells Bovine 06/22/2018
View

Summary

ApplicationOther
Sample Testedbovine ovarian granulosa cells,granulosa (ovarian) cells plated and grown on coverglassess,ovarian granulosa cells
SpeciesBovine
LotHB031-2B3

Comments

CommentsUnvalidated Species tested: cow

Sample: granulosa (ovarian) cells plated and grown on coverglassess

Protocol:
fixation: 4% PF for 7 minutes at rt
permeabilization: 0.1% Triton-X in PBS for 7 minutes.
Blocking: 20% donkey serum, 1% BSA in PBS, 1 hour at rt
Primary antibody: Mouse Monoclonal non-muscle Myosin IIA Antibody (2B3) 1:50 or 1:100 in 1% BSA/PBS over night at 4°C
Secondary antibody: donkey anti mouse -Alexa 488 (Invitrogen), 1:500
DNA Counterstaining: mounting medium with DAPI

Negative CTRL was performed by omitting the primary antibody, images were captured under an epifluorescence microscope using the exposure settings

Result: the antibody gives a good signal at both concentration tested

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for non-muscle Myosin IIA Antibody (H00004627-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional non-muscle Myosin IIA Products

Bioinformatics Tool for non-muscle Myosin IIA Antibody (H00004627-M03)

Discover related pathways, diseases and genes to non-muscle Myosin IIA Antibody (H00004627-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for non-muscle Myosin IIA Antibody (H00004627-M03)

Discover more about diseases related to non-muscle Myosin IIA Antibody (H00004627-M03).
 

Pathways for non-muscle Myosin IIA Antibody (H00004627-M03)

View related products by pathway.

PTMs for non-muscle Myosin IIA Antibody (H00004627-M03)

Learn more about PTMs related to non-muscle Myosin IIA Antibody (H00004627-M03).
 

Research Areas for non-muscle Myosin IIA Antibody (H00004627-M03)

Find related products by research area.

Blogs on non-muscle Myosin IIA

There are no specific blogs for non-muscle Myosin IIA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
06/22/2018
Application: immunofluorescence on in vitro grown cells
Species: Bovine

Bioinformatics

Gene Symbol MYH9
Entrez
OMIM