BCAP31 Antibody - BSA Free

Immunohistochemistry-Paraffin: BCAP31 Antibody [NBP1-89357] - Staining in human epididymis and skeletal muscle tissues using anti-BCAP31 antibody. Corresponding BCAP31 RNA-seq data are presented for the same tissues.

Western Blot: BCAP31 Antibody [NBP1-89357] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: BCAP31 Antibody [NBP1-89357] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Western Blot: BCAP31 Antibody [NBP1-89357] - Analysis in human cell line EFO-21.

Immunohistochemistry-Paraffin: BCAP31 Antibody [NBP1-89357] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: BCAP31 Antibody [NBP1-89357] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCAP31 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCAP31 Antibody - BSA Free (NBP1-89357) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BCAP31 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAP31
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  BCAP31 Protein (NBP1-89357PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BCAP31 Antibody - BSA Free

• 6C6-Ag
• BAP31
• Bap31,6C6-AG
• BAP31DXS1357ECDM
• BCAP31
• B-cell receptor-associated protein 31
• BCR-associated protein 31
• BCR-associated protein Bap31,6C6-AG tumor-associated antigen
• p28 Bap31,6C6-Ag
• p28
• Protein CDM

Background

BAP31 (B Cell Receptor Associated Protein, 28 kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo and hetero oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL2/BCLXL associated protein. In the C terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BCAP31 Antibody (NBP1-89357)(2)

Publications using NBP1-89357

• Kim Y, Kim Y, Kim B et al. A novel BCAP31 variant associated with nonsyndromic auditory neuropathy spectrum disorder: mitochondrial dysfunction, cisplatin sensitivity, and amenability to mitochondrial transplantation. Journal of translational medicine 2025-06-04 [PMID: 40462059]
• Salsano S, Gonzalez-Martin R, Quinonero A et al. Novel nonclassic progesterone receptor PGRMC1 pulldown-precipitated proteins reveal a key role during human decidualization Fertil. Steril. 2020-05-01 [PMID: 32386616]

Bioinformatics

• Gene Symbol: BCAP31