BCAP31 Antibody

Images

 
Western Blot: BCAP31 Antibody [NBP1-89357] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: BCAP31 Antibody [NBP1-89357] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: BCAP31 Antibody [NBP1-89357] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: BCAP31 Antibody [NBP1-89357] - Analysis in human cell line EFO-21.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCAP31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAP31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
BCAP31 Protein (NBP1-89357PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCAP31 Antibody

  • 6C6-Ag
  • BAP31
  • Bap31,6C6-AG
  • BAP31DXS1357ECDM
  • BCAP31
  • B-cell receptor-associated protein 31
  • BCR-associated protein 31
  • BCR-associated protein Bap31,6C6-AG tumor-associated antigen
  • p28 Bap31,6C6-Ag
  • p28
  • Protein CDM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00055973-D01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7070
Species: Hu, Rt
Applications: WB
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB6967
Species: Hu
Applications: WB

Publications for BCAP31 Antibody (NBP1-89357) (0)

There are no publications for BCAP31 Antibody (NBP1-89357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAP31 Antibody (NBP1-89357) (0)

There are no reviews for BCAP31 Antibody (NBP1-89357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BCAP31 Antibody (NBP1-89357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCAP31 Products

Bioinformatics Tool for BCAP31 Antibody (NBP1-89357)

Discover related pathways, diseases and genes to BCAP31 Antibody (NBP1-89357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAP31 Antibody (NBP1-89357)

Discover more about diseases related to BCAP31 Antibody (NBP1-89357).
 

Pathways for BCAP31 Antibody (NBP1-89357)

View related products by pathway.

PTMs for BCAP31 Antibody (NBP1-89357)

Learn more about PTMs related to BCAP31 Antibody (NBP1-89357).

Blogs on BCAP31

There are no specific blogs for BCAP31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCAP31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAP31
Entrez