BCAP31 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit BCAP31 Antibody - BSA Free (NBP1-89357) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BCAP31 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BCAP31 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for BCAP31 Antibody - BSA Free
Background
BAP31 (B Cell Receptor Associated Protein, 28 kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo and hetero oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL2/BCLXL associated protein. In the C terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Publications for BCAP31 Antibody (NBP1-89357)(2)
Showing Publications 1 -
2 of 2.
Reviews for BCAP31 Antibody (NBP1-89357) (0)
There are no reviews for BCAP31 Antibody (NBP1-89357).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BCAP31 Antibody (NBP1-89357) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BCAP31 Products
Research Areas for BCAP31 Antibody (NBP1-89357)
Find related products by research area.
|
Blogs on BCAP31