BAP29 Antibody

Immunocytochemistry/Immunofluorescence: BAP29 Antibody [NBP2-38606] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining of human thyroid gland.

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining in human testis and pancreas tissues using anti-BCAP29 antibody. Corresponding BCAP29 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining of human cerebral cortex, pancreas, testis and thyroid gland using Anti-BCAP29 antibody NBP2-38606 (A) shows similar protein distribution across tissues to independent antibody NBP1-90009 (B).

Immunohistochemistry-Paraffin: BAP29 Antibody [NBP2-38606] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BAP29 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAP29
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BAP29 Protein (NBP2-38606PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BAP29 Antibody

• Bap29
• BAP29DKFZp686M2086
• B-cell receptor-associated protein 29
• BCR-associated protein 29
• FLJ53907

Background

BAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAP29
• Uniprot:
  • Q9UHQ4(Human)