BBOX1 Antibody

Images

 
Western Blot: BBOX1 Antibody [NBP1-88695] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: BBOX1 Antibody [NBP1-88695] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.
Western Blot: BBOX1 Antibody [NBP1-88695] - Lane 1: Mouse liver tissue lysate. Lane 2: Rat liver tissue lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BBOX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BBOX1 Protein (NBP1-88695PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBOX1 Antibody

  • 2-oxoglutarate dioxygenase 1
  • 2-oxoglutarate dioxygenase
  • BBHgamma-butyrobetaine
  • BBOXEC 1.14.11.1
  • butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 1
  • Gamma-BBH
  • gamma-butyrobetaine dioxygenase
  • Gamma-butyrobetaine hydroxylase
  • Gamma-butyrobetaine
  • G-BBH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88693
Species: Hu
Applications: IHC, IHC-P
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1348
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for BBOX1 Antibody (NBP1-88695) (0)

There are no publications for BBOX1 Antibody (NBP1-88695).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBOX1 Antibody (NBP1-88695) (0)

There are no reviews for BBOX1 Antibody (NBP1-88695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BBOX1 Antibody (NBP1-88695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BBOX1 Products

Bioinformatics Tool for BBOX1 Antibody (NBP1-88695)

Discover related pathways, diseases and genes to BBOX1 Antibody (NBP1-88695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBOX1 Antibody (NBP1-88695)

Discover more about diseases related to BBOX1 Antibody (NBP1-88695).
 

Pathways for BBOX1 Antibody (NBP1-88695)

View related products by pathway.

Blogs on BBOX1

There are no specific blogs for BBOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBOX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BBOX1