BAAT Antibody (1E4.)

Images

 
Western Blot: BAAT Antibody (1E4) [H00000570-M03] - Analysis of BAAT expression in HL-60(Cat # L014V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BAAT Antibody (1E4.) Summary

Immunogen
BAAT (NP_001692 258 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BAAT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BAAT Antibody (1E4.)

  • BACAT
  • BATbile acid-CoA:amino acid N-acyltransferase
  • bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
  • bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase)
  • EC 2.3.1.65
  • EC 3.1.2.2
  • FLJ20300
  • Glycine N-choloyltransferase
  • Long-chain fatty-acyl-CoA hydrolase
  • MGC104432

Background

The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB5826
Species: Hu
Applications: WB, IHC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000570-M03
Species: Hu
Applications: WB, ELISA

Publications for BAAT Antibody (H00000570-M03) (0)

There are no publications for BAAT Antibody (H00000570-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAAT Antibody (H00000570-M03) (0)

There are no reviews for BAAT Antibody (H00000570-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAAT Antibody (H00000570-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAAT Products

Bioinformatics Tool for BAAT Antibody (H00000570-M03)

Discover related pathways, diseases and genes to BAAT Antibody (H00000570-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAAT Antibody (H00000570-M03)

Discover more about diseases related to BAAT Antibody (H00000570-M03).
 

Pathways for BAAT Antibody (H00000570-M03)

View related products by pathway.

PTMs for BAAT Antibody (H00000570-M03)

Learn more about PTMs related to BAAT Antibody (H00000570-M03).

Blogs on BAAT

There are no specific blogs for BAAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAAT Antibody (1E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol BAAT
Uniprot