B7-H3/CD276 Antibody - BSA Free

Western Blot: B7-H3/CD276 Antibody [NBP1-88966] - Western blot shows lysates of U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line. PVDF membrane was probed with 0.5 ug/mL of Rabbit Anti-Human B7-H3 Polyclonal Antibody (Catalog # NBP1-88966) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for B7-H3 at approximately 95 kDa (as indicated) in the parental U2OS cell line, but is not detectable in the knockout U2OS cell line. This experiment was conducted under reducing conditions.

Immunocytochemistry/Immunofluorescence: B7-H3/CD276 Antibody [NBP1-88966] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Western Blot: B7-H3/CD276 Antibody [NBP1-88966] - Analysis in control (vector only transfected HEK293T lysate) and CD276 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88966] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88966] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88966] -Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88966] -Staining of human cerebellum shows negative cytoplasmic positivity in Purkinje cells as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B7-H3/CD276 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD276
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  B7-H3/CD276 Protein (NBP1-88966PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B7-H3/CD276 Antibody - BSA Free

• B7H3
• B7-H3
• B7H34Ig-B7-H3
• B7-H3B7 homolog 3
• CD276 antigen
• CD276 molecule
• CD276
• Costimulatory molecule

Background

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B7-H3/CD276 Antibody (NBP1-88966)(2)

Publications using NBP1-88966

• Li S, Poolen GC, van Vliet LC et al. Pediatric medulloblastoma express immune checkpoint B7-H3 Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico 2022-01-05 [PMID: 34988920] (IHC-P, Human)
• Lemke D, Pfenning PN, Sahm F et al. Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness. Clin Cancer Res 2012-01-01 [PMID: 22080438]

Bioinformatics

• Gene Symbol: CD276