B7-H3/CD276 Antibody

Images

 
Western Blot: B7-H3/CD276 Antibody [NBP1-88965] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88965] - Immunohistochemical staining of human prostate shows strong membrane and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B7-H3/CD276 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD276
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B7-H3/CD276 Protein (NBP1-88965PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B7-H3/CD276 Antibody

  • B7H3
  • B7-H3
  • B7H34Ig-B7-H3
  • B7-H3B7 homolog 3
  • CD276 antigen
  • CD276 molecule
  • CD276
  • Costimulatory molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP2-30536
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-88965
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for B7-H3/CD276 Antibody (NBP1-88965) (0)

There are no publications for B7-H3/CD276 Antibody (NBP1-88965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B7-H3/CD276 Antibody (NBP1-88965) (0)

There are no reviews for B7-H3/CD276 Antibody (NBP1-88965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B7-H3/CD276 Antibody (NBP1-88965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B7-H3/CD276 Products

Bioinformatics Tool for B7-H3/CD276 Antibody (NBP1-88965)

Discover related pathways, diseases and genes to B7-H3/CD276 Antibody (NBP1-88965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B7-H3/CD276 Antibody (NBP1-88965)

Discover more about diseases related to B7-H3/CD276 Antibody (NBP1-88965).
 

Pathways for B7-H3/CD276 Antibody (NBP1-88965)

View related products by pathway.

PTMs for B7-H3/CD276 Antibody (NBP1-88965)

Learn more about PTMs related to B7-H3/CD276 Antibody (NBP1-88965).

Blogs on B7-H3/CD276

There are no specific blogs for B7-H3/CD276, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B7-H3/CD276 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD276
Entrez