B7-H3/CD276 Antibody - BSA Free

Western Blot: B7-H3/CD276 Antibody [NBP1-88965] - Western blot shows lysates of U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line. PVDF membrane was probed with 0.5 ug/mL of Rabbit Anti-Human B7-H3 Polyclonal Antibody (Catalog # NBP1-88965) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for B7-H3 at approximately 95 kDa (as indicated) in the parental U2OS cell line, but is not detectable in the knockout U2OS cell line. This experiment was conducted under reducing conditions.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88965] - Staining in human prostate and pancreas tissues using anti-CD276 antibody. Corresponding CD276 RNA-seq data are presented for the same tissues.

Western Blot: B7-H3/CD276 Antibody [NBP1-88965] - Analysis in control (vector only transfected HEK293T lysate) and CD276 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Western Blot: B7-H3/CD276 Antibody [NBP1-88965] - Analysis in human cell line HEK 293.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88965] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: B7-H3/CD276 Antibody [NBP1-88965] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B7-H3/CD276 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD276
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  B7-H3/CD276 Protein (NBP1-88965PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B7-H3/CD276 Antibody - BSA Free

• B7H3
• B7-H3
• B7H34Ig-B7-H3
• B7-H3B7 homolog 3
• CD276 antigen
• CD276 molecule
• CD276
• Costimulatory molecule

Background

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD276