Axl Antibody - BSA Free

Western Blot: Axl Antibody [NBP1-83073] - Analysis in control (vector only transfected HEK293T lysate) and AXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Axl Antibody [NBP1-83073] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Axl Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AXL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Axl Protein (NBP1-83073PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%). Reactivity reported in scientific literature (PMID: 23361052)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Axl Antibody - BSA Free

• AI323647
• ARK
• AXL oncogene
• AXL receptor tyrosine kinase
• AXL transforming sequence/gene
• Axl
• EC 2.7.10
• EC 2.7.10.1
• JTK11
• Tyro7
• tyrosine-protein kinase receptor UFO
• UFO
• UFOoncogene AXL

Background

Axl is encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Axl Antibody (NBP1-83073)(3)

Publications using NBP1-83073

• Nicol� L, Cappello F, Cappellesso R et al. RIPK3 and AXL Expression Study in Primary Cutaneous Melanoma Unmasks AXL as Predictor of Sentinel Node Metastasis: A Pilot Study Frontiers in Oncology 2021-10-21 [PMID: 34745951]
• Ong CW, Chong PY, McArt DG et al. The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers. Oncotarget 2015-05-20 [PMID: 25906747] (IF/IHC, Human)
• Pinato DJ, Mauri FA, Lloyd T et al. The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma. Br J Cancer 2013-02-19 [PMID: 23361052]

FAQs for Axl Antibody (NBP1-83073). (Showing 1 - 1 of 1 FAQs).

1. Do you know if any of them was tested in IHC and which one you would recommend for this application?
   • We currently have 1 antibody for Estrogen Receptor beta that has been validated for use in IHC-Paraffin in human, NBP1-83073.

Bioinformatics

• Gene Symbol: AXL