Novus Biologicals products are now on bio-techne.com

RNF111 Antibody (1C4)

Images

 
Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4. Lane 1: RNF111 transfected lysatE (107.8 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of monoclonal antibody to RNF111 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi or non-transfected control. Blot probed with ...read more
ELISA: RNF111 Antibody (1C4) [H00054778-M05] - Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, KD
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF111 Antibody (1C4) Summary

Immunogen
RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
Specificity
RNF111 - ring finger protein 111
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF111
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validaton and ELISA.
Publications
Read Publications using H00054778-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF111 Antibody (1C4)

  • ARK
  • Arkadia
  • DKFZp313E0731
  • DKFZp761D081
  • E3 ubiquitin-protein ligase Arkadia
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ38008
  • ring finger protein 111DKFZp686H1966

Background

The protein encoded by this gene contains a RING finger domain, a motif known to be involved in protein-protein and protein-DNA interactions. The mouse counterpart of this gene (Rnf111/arkadia) has been shown to genetically interact with the transforming growth factor (TGF) beta-like factor Nodal, and act as a modulator of the nodal signaling cascade, which is essential for the induction of mesoderm during embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF854
Species: Mu
Applications: IHC, WB
MAB868
Species: Hu
Applications: WB
NBP1-77306
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF759
Species: Mu
Applications: IHC, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
885-GSB
Species: Hu
Applications: BA
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77305
Species: Hu
Applications: ELISA, ICC/IF, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
3218-ND
Species: Hu
Applications: BA
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB500-218
Species: Hu, Mu
Applications: WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
MAB9080
Species: Hu
Applications: WB
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, KD

Publications for RNF111 Antibody (H00054778-M05)(12)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00054778-M05 Applications Species
Victor L, Florent D, Sadek A et al. Quantitative ubiquitylome analysis reveals specificity of RNF111/Arkadia E3 ubiquitin ligase for its degradative substrates SKI and SKIL/SnoN in TGF-? signaling pathway. Mol Cell Proteomics. 2021-11-03 [PMID: 34740826]
McIntosh DJ, Walters TS, Arinze IJ et al. Arkadia (RING Finger Protein 111) Mediates Sumoylation-Dependent Stabilization of Nrf2 Through K48-Linked Ubiquitination. Cell Physiol Biochem 2018-03-23 [PMID: 29597191]
van Cuijk L, van Belle GJ, Turkyilmaz Y et al. SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair. Nat Commun. 2015-07-07 [PMID: 26151477]
Gonzalez-Prieto R, Cuijpers SA, Kumar R et al. c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4. Cell Cycle 2015-01-01 [PMID: 25895136] (WB) WB
Poulsen SL, Hansen RK, Wagner SA et al. RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response. J Cell Biol. 2013-06-10 [PMID: 23751493]
Erker Y, Neyret-Kahn H, Seeler JS et al. Arkadia, a Novel SUMO-Targeted Ubiquitin Ligase Involved in PML Degradation. Mol Cell Biol. 2013-03-25 [PMID: 23530056]
Ma T, Chen Y, Zhang F et al. RNF111-Dependent Neddylation Activates DNA Damage-Induced Ubiquitination. Mol Cell. 2013-02-07 [PMID: 23394999]
Koinuma D, Shinozaki M, Nagano Y et al. RB1CC1 positively regulates transforming growth factor-{beta} signaling through the modulation of Arkadia E3 ubiquitin ligase activity. J Biol Chem. 2011-07-27 [PMID: 21795712]
Javelaud D, van Kempen L, Alexaki VI et al. Efficient TGF-beta/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression. Mol Cancer. 2011-01-06 [PMID: 21211030]
Nagano Y, Koinuma D, Miyazawa K, Miyazono K. Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells. J Biochem. 2009-12-02 [PMID: 19959502]
Show All 12 Publications.

Reviews for RNF111 Antibody (H00054778-M05) (0)

There are no reviews for RNF111 Antibody (H00054778-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF111 Antibody (H00054778-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF111 Products

Research Areas for RNF111 Antibody (H00054778-M05)

Find related products by research area.

Blogs on RNF111

There are no specific blogs for RNF111, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF111 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF111
Entrez
OMIM
Uniprot