Home » Axl » Axl Antibodies » Axl Antibody

Axl Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Axl Antibody [NBP1-83073] - Analysis in control (vector only transfected HEK293T lysate) and AXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Axl Antibody [NBP1-83073] - Analysis in control (vector only transfected HEK293T lysate) and AXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Axl Antibody [NBP1-83073] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Axl Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Specificity
Specificity of human Axl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AXL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Axl Protein (NBP1-83073PEP)
Publications
Read Publications using
NBP1-83073 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%). Reactivity reported in scientific literature (PMID: 23361052)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Axl Antibody

  • AI323647
  • ARK
  • AXL oncogene
  • AXL receptor tyrosine kinase
  • AXL transforming sequence/gene
  • Axl
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK11
  • Tyro7
  • tyrosine-protein kinase receptor UFO
  • UFO
  • UFOoncogene AXL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Gas6 [Unconjugated]
885-GSB
Gas6 [Unconjugated]
(5 Reviews)
(17 Publications)
Species: Hu
Dtk/TYRO3 Antibody
NBP1-28635
Western Blot: Dtk/TYRO3 Antibody [NBP1-28635] - Lane 1: Western blot on normal human brain, Lane 2: Western blot on normal mouse brain.
Immunocytochemistry/Immunofluorescence: Dtk/TYRO3 Antibody [NBP1-28635] - Staining of HELA cells using NBP128635 (Green) at a 1:200 dilution detected using Dylight-488 conjugated goat anti-rabbit secondary antibody. Nuclei were visualized using Hoechst 33258 (Blue).
Flow Cytometry: Dtk/TYRO3 Antibody [NBP1-28635] - An intracellular stain was performed on HeLa cells with Dtk/TYRO3 Antibody NBP1-28635AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, Flow-IC
Mer Antibody
[Unconjugated]
AF591
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Mer was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sperm cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Mer mRNA was detected in formalin-fixed paraffin-embedded tissue sections of mouse kidney probed with ACD RNAScope® Probe (Catalog # 441241) and stained using ACD RNAscope® 2.5 HD Detection Reagents-Red (top image, Catalog # 32260). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Goat Anti-Mouse Mer Antigen Affinity-purified Polyclonal Antibody (Catalog # AF591) at 1 ug/mL with overnight incubation at 4 °C followed by incubation with the Anti-Goat IgG VisUCyte HRP Polymer Antibody (R&D Systems,  Catalog # VC004) and DAB chromogen (lower image, yellow-brown). Tissues were counterstained with hematoxylin (blue).
(3 Reviews)
(30 Publications)
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
GPER/GPR30
Antibody [Unconjugate
AF5534
Western blot shows lysates of human brain cortex tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human GPER Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5534) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for GPER at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
GPER was detected in immersion fixed paraffin-embedded sections of human brain (hypothalamus) using Goat Anti-Human GPER Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5534) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
HEK293 human embryonic kidney cell line transfected with (A) human GPER/GRP30 or (B) irrelevant transfectants, and eGFP was stained with Goat Anti-Human GPER/GPR30 Affinity-Purified Polyclonal Antibody (Catalog # AF5534) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). Quadrants were set based on Goat IgG Flow Cytometry Isotype Control (Catalog # AB-108-C, data not shown). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
RNF111 Antibody
(1C4)
H00054778-M05
Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4. Lane 1: RNF111 transfected lysatE (107.8 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: RNF111 Antibody (1C4) [H00054778-M05] - Analysis of monoclonal antibody to RNF111 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: RNF111 Antibody (1C4) [H00054778-M05] - Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi or non-transfected control. Blot probed with H00054778-M05. GAPDH (36.1 kDa) used as loading control.
(11 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(9 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(29 Reviews)
(636 Publications)
Species: Hu
HGFR/c-MET
Antibody [Unconjugate
AF527
HGF R/c‑MET was detected in immersion fixed HT‑29 human colon adenocarcinoma cell line (positive control, left panel) and U937 human histiocytic lymphoma cell line (negative control, right panel) using Goat Anti-Mouse HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF527) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HGF R/c‑MET was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF527) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in muscle cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Reviews)
(21 Publications)
Species: Mu
Applications: WB, IHC, Block, ICC
RNMT Antibody
(3H3-1D12)
H00008731-M01
Western Blot: RNMT Antibody (3H3-1D12) [H00008731-M01] - RNMT monoclonal antibody (M01), clone 3H3-1D12 Analysis of RNMT expression in HeLa.
Immunocytochemistry/Immunofluorescence: RNMT Antibody (3H3-1D12) [H00008731-M01] - Analysis of monoclonal antibody to RNMT on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RNMT Antibody (3H3-1D12) [H00008731-M01] - Analysis of monoclonal antibody to RNMT on formalin-fixed paraffin-embedded human squamous cell carcinoma tissue. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PIK3CA Antibody
NBP2-19804
Western Blot: PIK3CA Antibody [NBP2-19804] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 alpha antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PIK3CA Antibody [NBP2-19804] - HCT 116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PI3 kinase p110 alpha protein stained by PI3 kinase p110 alpha antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PIK3CA Antibody [NBP2-19804] - PIK3CA Antibody Immunohistochemical analysis of paraffin-embedded Human Breast Cancer, using PI3 kinase p110 alpha antibody.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SLTM Antibody
NBP2-38464
Western Blot: SLTM Antibody [NBP2-38464] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: SLTM Antibody [NBP2-38464] - Staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLTM Antibody [NBP2-38464] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(42 Publications)
Species: Hu
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PI 3-Kinase p110
beta/PIK3CB Antibody ...
NBP2-88937
Western Blot: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Analysis in human cell line HEL.
Immunocytochemistry/Immunofluorescence: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of A-431 cells using the Anti-PIK3CB monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Human Breast Cancer, using PI3K gamma antibody. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Whole cell extract (30ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for Axl Antibody (NBP1-83073)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Axl Antibody (NBP1-83073) (0)

There are no reviews for Axl Antibody (NBP1-83073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Axl Antibody (NBP1-83073). (Showing 1 - 1 of 1 FAQs).

  1. Do you know if any of them was tested in IHC and which one you would recommend for this application?
    • We currently have 1 antibody for Estrogen Receptor beta that has been validated for use in IHC-Paraffin in human, NBP1-83073.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Axl Products

Bioinformatics Tool for Axl Antibody (NBP1-83073)

Discover related pathways, diseases and genes to Axl Antibody (NBP1-83073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axl Antibody (NBP1-83073)

Discover more about diseases related to Axl Antibody (NBP1-83073).
 

Pathways for Axl Antibody (NBP1-83073)

View related products by pathway.

PTMs for Axl Antibody (NBP1-83073)

Learn more about PTMs related to Axl Antibody (NBP1-83073).
 

Research Areas for Axl Antibody (NBP1-83073)

Find related products by research area.

Blogs on Axl.

Check out the latest blog posts on Axl.
Microglia: pruning shears for homeostatic maintenance in the brain
By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Axl Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AXL
COVID-19 update