Aurora B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Aurora B Antibody [NBP2-55144] - Staining of human cell line U-2 OS shows localization to nucleoplasm & midbody. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aurora B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aurora B Antibody - BSA Free (NBP2-55144) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AURKB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aurora B Recombinant Protein Antigen (NBP2-55144PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aurora B Antibody - BSA Free

• Aik2
• AIK2EC 2.7.11.1
• AIM1
• AIM-1
• AIM1Aik2
• AIM-1STK-1
• ARK2
• ARK2ARK-2
• AurB
• AURKB
• aurkb-sv2
• Aurora- and IPL1-like midbody-associated protein 1
• Aurora B
• aurora kinase BSerine/threonine-protein kinase aurora-B
• aurora kinase B-Sv1
• aurora kinase B-Sv2
• Aurora/IPL1-related kinase 2
• aurora-1
• aurora-B
• Aurora-related kinase 2
• EC 2.7.11
• IPL1
• serine/threonine kinase 12
• serine/threonine-protein kinase 12
• STK12
• STK12aurkb-sv1
• STK5

Background

Aurora-B is a member of a novel family of serine/threonine kinases that have been identified as key regulators of the mitotic cell division process. Aurora-B is known to be involved in the regulation of centrosome function, bipolar spindle assembly and chromosome segregation. Aurora kinases are localized at the centrosomes of interphase cells, at the poles of the bipolar spindle and in the midbody of the mitotic apparatus. Substrates identified for the Aurora-B kinases include a kinesin-like motor protein, spindle apparatus proteins, histone H3 protein, kinetochore protein and the tumor suppressor protein p53 (1). Overexpression of aurora B produced multinuclearity and induced aggressive metastasis, suggesting that overexpressed aurora B has multiple functions in cancer development. Identification of Aurora kinases as RasGAP Src homology 3 domain binding protein, also implicates these kinases as potential effectors in the Ras pathway relevant to oncogenesis (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AURKB