Borealin Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: Borealin Antibody [NBP1-89951] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Orthogonal Strategies: Analysis in human testis and skeletal muscle tissues using NBP1-89951 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human lymphoid tissues shows moderate nuclear positivity in germinal center cells.
Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa ...read more
Borealin-Antibody-Western-Blot-NBP1-89951-img0018.jpg
Biological Strategies: Borealin-Antibody-Western-Blot-NBP1-89951-img0017.jpg
Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

Borealin Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Borealin Antibody - BSA Free (NBP1-89951) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Borealin Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDCA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Borealin Protein (NBP1-89951PEP)
Publications
Read Publications using
NBP1-89951 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Borealin Antibody - BSA Free

  • BOR
  • BOREALIN
  • cell division cycle associated 8
  • Cell division cycle-associated protein 8
  • Dasra B
  • DasraB
  • dasra-B
  • FLJ10468
  • FLJ12042
  • hDasra-B
  • MESRGP
  • PESCRG3
  • Pluripotent embryonic stem cell-related gene 3 protein

Background

Borealin (CDCA8) is a component of the chromosomal passenger complex (CPC), which is required for stability of the bipolar mitotic spindle and acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA.

Borealin has been shown to interact with Aurora B and survivin (BIRC5). Knockdown of Borealin by small interfering RNA resulted in severe chromosome misalignment at metaphase and accumulation of multiple interphase nuclei. Borealin is also related to the proliferation of human embryonic stem (hES) cells and is highly expressed in mouse undifferentiated ES cells.
Borealin antibodies are useful tools for stem cell studies and cell division research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP2-87382
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-84264
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF6028
Species: Hu
Applications: IHC, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1103
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF755
Species: Mu
Applications: Block, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Borealin Antibody (NBP1-89951)(4)

Reviews for Borealin Antibody (NBP1-89951) (0)

There are no reviews for Borealin Antibody (NBP1-89951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Borealin Antibody (NBP1-89951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Borealin Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCA8