AUF1 Antibody

Western Blot: AUF1 Antibody [NBP1-88915] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: AUF1 Antibody [NBP1-88915] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: AUF1 Antibody [NBP1-88915] - Staining of human stomach shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AUF1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AUF1 Protein (NBP1-88915PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AUF1 Antibody

• AUF1A
• heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa)
• heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD)
• heterogeneous nuclear ribonucleoprotein D0
• hnRNPD0
• type A

Background

hnRNP D/AUF1 binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3' untranslated regions of many protooncogenes and cytokine mRNAs. It also binds to double and single stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single stranded nonmonotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. It may be involved in translationally coupled mRNA turnover (referenced from swissprot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AUF1 Antibody (NBP1-88915)(1)

Publication using NBP1-88915

• Gao J, Shi H, Juhlin C Et al. Merkel cell polyomavirus T-antigens regulate DICER1 mRNA stability and translation through HSC70 iScience 2021-11-01 [PMID: 34761184] (WB, Human)

Bioinformatics

• Gene Symbol: HNRNPD