ATP6V0A1 Antibody - BSA Free

Western Blot: ATP6V0A1 Antibody [NBP1-59949] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6V0A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP6V0A1(ATPase, H+ transporting, lysosomal V0 subunit a1) The peptide sequence was selected from the N terminal of ATP6V0A1. Peptide sequence RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: a isoform 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V0A1 Antibody - BSA Free

• a1
• ATP6N1
• ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
• ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• ATPase, H+ transporting, lysosomal V0 subunit a1
• Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
• DKFZp781J1951
• Stv1
• Vacuolar adenosine triphosphatase subunit Ac116
• Vacuolar proton pump subunit 1
• vacuolar proton pump, subunit 1
• Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
• vacuolar proton translocating ATPase 116 kDa subunit A
• vacuolar-type H(+)-ATPase 115 kDa subunit
• V-ATPase 116 kDa isoform a1
• V-ATPase 116 kDa
• Vph1
• VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
• V-type proton ATPase 116 kDa subunit a isoform 1
• V-type proton ATPase 116 kDa subunit a

Background

ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0A1 Antibody (NBP1-59949)(2)

Publications using NBP1-59949

• Immunotherapy OC, Viitala M MACROPHAGES TO ACTIVATE ANTITUMOR IMMUNITY Thesis 2023-01-01
• Virtakoivu R, Rannikko JH, Viitala M et al. Systemic Blockade of Clever-1 Elicits Lymphocyte Activation Alongside Checkpoint Molecule Downregulation in Patients with Solid Tumors: Results from a Phase I/II Clinical Trial Clinical Cancer Research 2021-08-01 [PMID: 34078651] (Western Blot, In vivo assay)

Bioinformatics

• Gene Symbol: ATP6V0A1
• Uniprot:
  • Q93050(Human)