BBS9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BBS9 Antibody [NBP1-88927] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BBS9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBS9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BBS9 Protein (NBP1-88927PEP)
Publications
Read Publications using
NBP1-88927 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 23150559)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBS9 Antibody

  • B1
  • Bardet-Biedl syndrome 9 protein
  • Bardet-Biedl syndrome 9
  • C18
  • D1
  • Parathyroid hormone-responsive B1 gene protein
  • protein PTHB1
  • PTHB1MGC118917
  • PTH-responsive osteosarcoma B1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF1396
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BBS9 Antibody (NBP1-88927)(3)

Reviews for BBS9 Antibody (NBP1-88927) (0)

There are no reviews for BBS9 Antibody (NBP1-88927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BBS9 Antibody (NBP1-88927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BBS9 Products

Bioinformatics Tool for BBS9 Antibody (NBP1-88927)

Discover related pathways, diseases and genes to BBS9 Antibody (NBP1-88927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS9 Antibody (NBP1-88927)

Discover more about diseases related to BBS9 Antibody (NBP1-88927).
 

Pathways for BBS9 Antibody (NBP1-88927)

View related products by pathway.

Research Areas for BBS9 Antibody (NBP1-88927)

Find related products by research area.

Blogs on BBS9

There are no specific blogs for BBS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBS9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS9