Recombinant Human PLP2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human PLP2 Protein [H00005355-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human PLP2 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 152 of Human PLP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PLP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
43.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLP2 GST (N-Term) Protein

  • A4 differentiation-dependent protein
  • A4A4LSB
  • A4-LSB
  • Differentiation-dependent protein A4
  • Intestinal membrane A4 protein
  • MGC126187
  • proteolipid protein 2 (colonic epithelium-enriched)
  • proteolipid protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37456
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for PLP2 Recombinant Protein (H00005355-P01) (0)

There are no publications for PLP2 Recombinant Protein (H00005355-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLP2 Recombinant Protein (H00005355-P01) (0)

There are no reviews for PLP2 Recombinant Protein (H00005355-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLP2 Recombinant Protein (H00005355-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PLP2 Products

Bioinformatics Tool for PLP2 Recombinant Protein (H00005355-P01)

Discover related pathways, diseases and genes to PLP2 Recombinant Protein (H00005355-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLP2 Recombinant Protein (H00005355-P01)

Discover more about diseases related to PLP2 Recombinant Protein (H00005355-P01).
 

Pathways for PLP2 Recombinant Protein (H00005355-P01)

View related products by pathway.

PTMs for PLP2 Recombinant Protein (H00005355-P01)

Learn more about PTMs related to PLP2 Recombinant Protein (H00005355-P01).

Blogs on PLP2

There are no specific blogs for PLP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLP2