Home » ATP5D » ATP5D Antibodies » ATP5D Antibody

ATP5D Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ATP5D Antibody [NBP2-84480] - Host: Rabbit. Target Name: ATP5D. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ATP5D Antibody [NBP2-84480] - Host: Rabbit. Target Name: ATP5D. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ATP5D Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ATP5D. Peptide sequence: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5F1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5D Antibody

  • ATP synthase subunit delta, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
  • F-ATPase delta subunit
  • mitochondrial ATP synthase complex delta-subunit precusor
  • mitochondrial ATP synthase, delta subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Fibrillin 1
Antibody (11C1.3)
NB110-8146
Immunohistochemistry-Frozen: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Adult eye (blue) and muscle (red) tissue. An image was captured using epifluorescent microscope detecting signals from Alexa fluor 568 conjugated secondary antibody. Used at 1:100 dilution. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Analysis of Fibrillin-1 (green) showing staining in the cytoplasm of A431 cells (right) compared to a negative control without primary antibody (left).
Immunocytochemistry/Immunofluorescence: Fibrillin 1 Antibody (11C1.3) [NB110-8146] - Analysis of Fibrillin-1 (green) showing staining in the cytoplasm of SH-SY5Y cells (right) compared to a negative control without primary antibody (left).
(1 Review)
(5 Publications)
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
PGK1 Antibody
NBP2-19784
Western Blot: PGK1 Antibody [NBP2-19784] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PGK1 antibody diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PGK1 Antibody [NBP2-19784] - Analysis of methanol-fixed HeLa, using antibody at 1:50 dilution.
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-19784] - Analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
SPARC Antibody
[Unconjugated]
AF942
Western blot shows lysates of C2C12 mouse myoblast cell line and mouse placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SPARC at approximately 35-37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SPARC/Osteonectin was detected in immersion fixed frozen sections of mouse embryo (E15) using Mouse SPARC/Osteonectin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing cartilage. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SPARC was detected in immersion fixed C2C12 mouse myoblast cell line using Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to endoplasmic reticuli. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(20 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Fibulin-3/EFEMP1
Antibody
NBP2-57871
Western Blot: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Staining of retina shows cytoplasmic positivity in all layers except inner nuclear layer.
Immunohistochemistry-Paraffin: Fibulin-3/EFEMP1 Antibody [NBP2-57871] - Analysis in human placenta and liver tissues. Corresponding EFEMP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry: HIF-2 alpha/EPAS1 Antibody [NB100-122] - Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
Immunohistochemistry: HIF-2 alpha/EPAS1 Antibody [NB100-122] - Expression of hypoxia-inducible alpha subunits in normal and diseased lung tissue. HIF-2alpha expression are more evident in fibroblasts from idiopathic pulmonary fibrosis (d) than from lung tissue affected by other inflammatory conditions (i.e. chronic bronchitis, panel e) or normal lung tissue (f); as demonstrated by a higher proportion of positive fibroblasts (open arrows) than negative ones (solid black arrows). Image collected and cropped by CiteAb from the following publication (https://respiratory-research.biomedcentral.com/articles/10.1186/s12931-019-1100-4) licensed under a CC-BY licence.
Western Blot: HIF-2 alpha/EPAS1 Antibody [NB100-122] - WNT11 is induced by hypoxia or hypoxic mimetics in different cell types. Immunoblot analyses of HeLa cells under normal air or hypoxia for 24 hrs. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep21520) licensed under a CC-BY licence.
(37 Reviews)
(710 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA
CTGF/CCN2 Antibody
(88430) - C-terminus
MAB660
CTGF/CCN2 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 25 µg/mL Human CTGF/CCN2 C-Terminus Monoclonal Antibody (Catalog # MAB660) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(6 Publications)
Species: Hu
Applications: IHC
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10ug/ml.
Western Blot: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Lane 1: MW marker; Lane 2: HO-1 (rat), (recombinant); Lane 3: HO-1 (human), (recombinant); Lane 4: HO-2 (human), (recombinant); Lane 5: MDBK cell lysate; Lane 6: Dog liver microsome; Lane 7: Mouse liver microsome.
(1 Review)
(16 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Protein Kinase D2
Antibody (OTI5G1)
NBP2-02984
Western Blot: Protein Kinase D2 Antibody (5G1) [NBP2-02984] Analysis of extracts (35ug) from 9 different cell lines by using anti-Protein Kinase D2 monoclonal antibody.
Flow Cytometry: Protein Kinase D2 Antibody (5G1) [NBP2-02984] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Protein Kinase D2 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Protein Kinase D2 Antibody (5G1) [NBP2-02984] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Protein Kinase D2.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Endoglin/CD105
[HRP]
DNDG00
(35 Publications)
Species: Hu
Applications: ELISA
Integrin alpha
E/CD103 Antibody (Ber ...
NBP1-97564
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on human peripheral blood cells with anti-CD103 (Ber-ACT8) APC.
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on PHA-activated PBMC with anti-CD103 (Ber-ACT8) FITC.
Flow Cytometry: Integrin alpha E/CD103 Antibody (Ber-ACT8) [NBP1-97564] - Staining of CD103 on PHA-activated PBMC with anti-CD103 (Ber-ACT8) PE.
(1 Publication)
Species: Hu, Pm
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-Fr, IP, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Galectin-3
Antibody [Unconjugate
AF1197
Western blot shows lysates of MCF‑7 human breast cancer cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, C6 rat glioma cell line, and NR8383 rat alveolar macrophage cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Galectin‑3 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin‑3 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c., cross-section through the eye) using Goat Anti-Human Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197 ) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HT‑2 mouse T cell line and Balb/3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑3 at approximately 44 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse Galectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1197) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-Page: Recombinant Human ATP5G3 Protein [H00000518-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PKC mu Antibody
NBP1-87789
Immunocytochemistry/Immunofluorescence: PKC mu Antibody [NBP1-87789] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PKC mu Antibody [NBP1-87789] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela C: Hep G2 D: Molt-4 12% SDS PAGE; antibody diluted at 1:10000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Integrin alpha 5
beta 1 [Unconjugated]
3230-A5
Integrin alpha 5 beta 1 [Unconjugated]
(2 Reviews)
(13 Publications)
Species: Hu
Applications: Bind
ATP5D Antibody
NBP2-84480
ATP5D Antibody
Species: Hu
Applications: WB

Publications for ATP5D Antibody (NBP2-84480) (0)

There are no publications for ATP5D Antibody (NBP2-84480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5D Antibody (NBP2-84480) (0)

There are no reviews for ATP5D Antibody (NBP2-84480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5D Antibody (NBP2-84480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5D Products

Array NBP2-84480

Bioinformatics Tool for ATP5D Antibody (NBP2-84480)

Discover related pathways, diseases and genes to ATP5D Antibody (NBP2-84480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5D Antibody (NBP2-84480)

Discover more about diseases related to ATP5D Antibody (NBP2-84480).
 

Pathways for ATP5D Antibody (NBP2-84480)

View related products by pathway.

Research Areas for ATP5D Antibody (NBP2-84480)

Find related products by research area.

Blogs on ATP5D

There are no specific blogs for ATP5D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5D Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP5F1D