ATP5D Antibody - BSA Free

Western Blot: ATP5D Antibody [NBP2-84480] - Host: Rabbit. Target Name: ATP5D. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP5D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5D Antibody - BSA Free (NBP2-84480) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP5D. Peptide sequence: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5F1D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP5D Antibody - BSA Free

• ATP synthase subunit delta, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
• F-ATPase delta subunit
• mitochondrial ATP synthase complex delta-subunit precusor
• mitochondrial ATP synthase, delta subunit

Background

The ATP5D gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis,utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATPsynthase is composed of two linke

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5F1D