ATP5D Antibody

Images

 
Western Blot: ATP5D Antibody [NBP2-84480] - Host: Rabbit. Target Name: ATP5D. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP5D Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ATP5D. Peptide sequence: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5F1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5D Antibody

  • ATP synthase subunit delta, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
  • F-ATPase delta subunit
  • mitochondrial ATP synthase complex delta-subunit precusor
  • mitochondrial ATP synthase, delta subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-57871
Species: Hu
Applications: IHC, IHC-P, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02984
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DNDG00
Species: Hu
Applications: ELISA
NBP1-97564
Species: Hu, Pm
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-Fr, IP, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-84480
Species: Hu
Applications: WB

Publications for ATP5D Antibody (NBP2-84480) (0)

There are no publications for ATP5D Antibody (NBP2-84480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5D Antibody (NBP2-84480) (0)

There are no reviews for ATP5D Antibody (NBP2-84480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5D Antibody (NBP2-84480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5D Products

Array NBP2-84480

Bioinformatics Tool for ATP5D Antibody (NBP2-84480)

Discover related pathways, diseases and genes to ATP5D Antibody (NBP2-84480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5D Antibody (NBP2-84480)

Discover more about diseases related to ATP5D Antibody (NBP2-84480).
 

Pathways for ATP5D Antibody (NBP2-84480)

View related products by pathway.

Research Areas for ATP5D Antibody (NBP2-84480)

Find related products by research area.

Blogs on ATP5D

There are no specific blogs for ATP5D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5F1D