ATG16L2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATG16L2 Antibody [NBP2-14326] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATG16L2 Antibody [NBP2-14326] - Staining of human colon shows strong cytoplasmic positivity in ganglion cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG16L2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQ RYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG16L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
ATG16L2 Protein (NBP2-14326PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG16L2 Antibody

  • APG16-like 2
  • ATG16 autophagy related 16-like 2 (S. cerevisiae)
  • ATG16B
  • autophagy-related protein 16-2
  • FLJ00012
  • WDR80WD repeat-containing protein 80

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-90731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF7006
Species: Hu, Mu
Applications: WB, IHC
AF826
Species: Hu, Mu
Applications: WB
NBP1-89043
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-14326
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATG16L2 Antibody (NBP2-14326) (0)

There are no publications for ATG16L2 Antibody (NBP2-14326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG16L2 Antibody (NBP2-14326) (0)

There are no reviews for ATG16L2 Antibody (NBP2-14326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATG16L2 Antibody (NBP2-14326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG16L2 Products

Bioinformatics Tool for ATG16L2 Antibody (NBP2-14326)

Discover related pathways, diseases and genes to ATG16L2 Antibody (NBP2-14326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG16L2 Antibody (NBP2-14326)

Discover more about diseases related to ATG16L2 Antibody (NBP2-14326).
 

Pathways for ATG16L2 Antibody (NBP2-14326)

View related products by pathway.

PTMs for ATG16L2 Antibody (NBP2-14326)

Learn more about PTMs related to ATG16L2 Antibody (NBP2-14326).

Blogs on ATG16L2.

ATG16L2 - An autophagy-related protein with unknown functions
Autophagy is a process by which cells degrade and recycle damaged organelles or misfolded proteins. These various cargo are engulfed in a double-membrane structure called the autophagosome. The autophagosome then fuses with the lysosome to facilit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG16L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG16L2