ATG4C Antibody

Images

 
Western Blot: ATG4C Antibody [NBP1-89043] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ATG4C Antibody [NBP1-89043] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ATG4C Antibody [NBP1-89043] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG4C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG4C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATG4C Protein (NBP1-89043PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG4C Antibody

  • APG4 autophagy 4 homolog C (S. cerevisiae)
  • APG4 autophagy 4 homolog C
  • APG4C
  • ATG4 autophagy related 4 homolog C (S. cerevisiae)
  • AUT (S. cerevisiae)-like 1, cysteine endopeptidase; AUT-like 1, cysteineendopeptidase (S. cerevisiae)
  • AUTL1
  • AUTL3APG4-C
  • AUT-like 1, cysteine endopeptidase
  • AUT-like 3 cysteine endopeptidase
  • autophagin-3
  • Autophagy-related cysteine endopeptidase 3
  • Autophagy-related protein 4 homolog C
  • cysteine protease ATG4C
  • EC 3.4.22
  • EC 3.4.22.-
  • FLJ14867

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB4324
Species: Hu, Mu
Applications: WB, IP, ICC
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24733
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89043
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATG4C Antibody (NBP1-89043) (0)

There are no publications for ATG4C Antibody (NBP1-89043).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4C Antibody (NBP1-89043) (0)

There are no reviews for ATG4C Antibody (NBP1-89043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATG4C Antibody (NBP1-89043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG4C Products

Bioinformatics Tool for ATG4C Antibody (NBP1-89043)

Discover related pathways, diseases and genes to ATG4C Antibody (NBP1-89043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG4C Antibody (NBP1-89043)

Discover more about diseases related to ATG4C Antibody (NBP1-89043).
 

Pathways for ATG4C Antibody (NBP1-89043)

View related products by pathway.

PTMs for ATG4C Antibody (NBP1-89043)

Learn more about PTMs related to ATG4C Antibody (NBP1-89043).
 

Research Areas for ATG4C Antibody (NBP1-89043)

Find related products by research area.

Blogs on ATG4C.

ATG4C - A regulator of the early steps of autophagosome assembly
Autophagy is an important cellular process that maintains homeostasis by degrading and recycling damaged proteins and organelles. Autophagy receptors, such as p62/SQSTM1, recognize these intracellular cargo and mediate their engulfment by the doubl...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG4C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4C