| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WIPI1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 26158518). For IHC-Paraffin, HIER pH 6 retrieval is recommended. WIPI1 antibody validated for Simple Western from a verified customer review. See Simple Western Antibody Database for Simple Western validation: Tested in mouse brain lysate, separated by Size, antibody dilution of 1:50 - 1:1000 |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Simple Western | Mouse | 03/25/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for WIPI1 Antibody (NBP1-88878)Find related products by research area.
|
|
Epigenetic Control of Autophagy By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi... Read full blog post. |
|
WIPI1 - An essential regulator of early autophagosome assembly WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 03/25/2016 |
||
| Application: | Simple Western | |
| Species: | Mouse |
| Gene Symbol | WIPI1 |