Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | WIPI1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB reported in scientific literature (PMID: 26158518). For IHC-Paraffin, HIER pH 6 retrieval is recommended. WIPI1 antibody validated for Simple Western from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Anonymous - |
Simple Western | Mouse | 03/25/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for WIPI1 Antibody (NBP1-88878)Discover more about diseases related to WIPI1 Antibody (NBP1-88878).
| Pathways for WIPI1 Antibody (NBP1-88878)View related products by pathway.
|
PTMs for WIPI1 Antibody (NBP1-88878)Learn more about PTMs related to WIPI1 Antibody (NBP1-88878).
| Research Areas for WIPI1 Antibody (NBP1-88878)Find related products by research area.
|
Epigenetic Control of Autophagy By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi... Read full blog post. |
WIPI1 - An essential regulator of early autophagosome assembly WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | WIPI1 |