WIPI1 Antibody

Images

 
Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human duodenum shows strong positivity in subsets of glandular cells.
Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WIPI1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WIPI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WIPI1 Protein (NBP1-88878PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88878 in the following applications:

Publications
Read Publication using
NBP1-88878 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26158518).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WIPI1 Antibody

  • Atg18 protein homolog
  • Atg18
  • ATG18A
  • FLJ10055
  • WD repeat domain phosphoinositide-interacting protein 1
  • WD repeat domain, phosphoinositide interacting 1
  • WD40 repeat protein interacting with phosphoinositides of 49 kDa
  • WD40 repeat protein Interacting with phosphoInositides of 49kDa
  • WIPI 49 kDa
  • WIPI-1 alpha
  • WIPI-1
  • WIPI49ATG18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-88879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
AF853
Species: Mu
Applications: WB, IHC
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24594
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-80838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WIPI1 Antibody (NBP1-88878)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for WIPI1 Antibody (NBP1-88878) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: Simple Western.

Reviews using NBP1-88878:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western WIPI1 NBP1-88878
Enlarge
reviewed by:
Anonymous
Simple Western Mouse 03/25/2016
View

Summary

ApplicationSimple Western
Sample Testedmouse whole brain lysate
SpeciesMouse

Blocking

Blocking Detailsn/a

Primary Anitbody

Dilution Ratio1:1000, 1:250, 1:50

Details

Detection NotesWes Simple Western platform

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WIPI1 Antibody (NBP1-88878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WIPI1 Products

Bioinformatics Tool for WIPI1 Antibody (NBP1-88878)

Discover related pathways, diseases and genes to WIPI1 Antibody (NBP1-88878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WIPI1 Antibody (NBP1-88878)

Discover more about diseases related to WIPI1 Antibody (NBP1-88878).
 

Pathways for WIPI1 Antibody (NBP1-88878)

View related products by pathway.

PTMs for WIPI1 Antibody (NBP1-88878)

Learn more about PTMs related to WIPI1 Antibody (NBP1-88878).

Blogs on WIPI1.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/25/2016
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol WIPI1