WIPI1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Analysis in human placenta and fallopian tube tissues using NBP1-88878 antibody. Corresponding WIPI1 RNA-seq data are presented ...read more
Orthogonal Strategies: Western Blot: WIPI1 Antibody [NBP1-88878] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-WIPI1 antibody. Corresponding WIPI1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular and enteroendocrine cells.
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human fallopian tube shows very weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic and decidual cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

WIPI1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit WIPI1 Antibody - BSA Free (NBP1-88878) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-WIPI1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WIPI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Simple Western 1:50-1:1000
  • Western Blot 1:100-1:500
Application Notes
WB reported in scientific literature (PMID: 26158518). For IHC-Paraffin, HIER pH 6 retrieval is recommended. WIPI1 antibody validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in mouse brain lysate, separated by Size, antibody dilution of 1:50 - 1:1000
Control Peptide
WIPI1 Protein (NBP1-88878PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88878 in the following applications:

Publications
Read Publication using
NBP1-88878 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26158518).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WIPI1 Antibody - BSA Free

  • Atg18 protein homolog
  • Atg18
  • ATG18A
  • FLJ10055
  • WD repeat domain phosphoinositide-interacting protein 1
  • WD repeat domain, phosphoinositide interacting 1
  • WD40 repeat protein interacting with phosphoinositides of 49 kDa
  • WD40 repeat protein Interacting with phosphoInositides of 49kDa
  • WIPI 49 kDa
  • WIPI-1 alpha
  • WIPI-1
  • WIPI49ATG18

Background

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP1-88879
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
AF853
Species: Mu
Applications: IHC, WB
H00200576-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP2-38524
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NB100-56398
Species: Hu
Applications: ICC/IF, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80838
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
H00009896-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for WIPI1 Antibody (NBP1-88878)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for WIPI1 Antibody (NBP1-88878) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-88878:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western WIPI1 NBP1-88878
Enlarge
4
reviewed by:
Verified Customer
Simple Western Mouse 03/25/2016
View

Summary

ApplicationSimple Western
Sample Testedmouse whole brain lysate
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WIPI1 Antibody (NBP1-88878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WIPI1 Products

Research Areas for WIPI1 Antibody (NBP1-88878)

Find related products by research area.

Blogs on WIPI1.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi...  Read full blog post.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
03/25/2016
Application: Simple Western
Species: Mouse

Bioinformatics

Gene Symbol WIPI1