ATG12 Antibody - BSA Free

Images

 
Staining of human cell line SiHa shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

ATG12 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ATG12 Antibody - BSA Free (NBP3-25289) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody has been engineered to specifically recognize the recombinant protein ATG12 using the following amino acid sequence: SEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATG12 Antibody - BSA Free

  • Apg12 (autophagy 12, S. cerevisiae)-like
  • APG12 autophagy 12-like (S. cerevisiae)
  • APG12
  • APG12HAPG12
  • APG12-like
  • ATG12 autophagy related 12 homolog (S. cerevisiae)
  • ATG12
  • Autophagy-related protein 12
  • FBR93
  • HAPG12
  • ubiquitin-like protein ATG12
  • yeast) homolog

Background

The ATG12 gene codes a ubiquitin-like protein ATG12 that in isoform 1 is 140 amino acids long at 15 kDA and in isoform 2 is 74 amino acids long at 7 kDA. This protein is critical for autophagy (bulk protein degradation) as it is the human homolog of a yeast protein that participates in autophagy. ATG12 participates in the immune system, apoptosis and autophagy, protein stability, negative regulators of RIG-I/MDA5 signaling, and glucose/energy metabolism. It is known to interact with various genes such as HIST1H2BF, HIST1H2BE, HIST1H2BI, HIST1H2BG, and HIST1H2BC. ATG12 has been researched regarding its role in leukemia, lung cancer, myositis, retinitis, carcinoma, colorectal cancer, and myelodysplastic syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP2-38524
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-25289
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ATG12 Antibody (NBP3-25289) (0)

There are no publications for ATG12 Antibody (NBP3-25289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG12 Antibody (NBP3-25289) (0)

There are no reviews for ATG12 Antibody (NBP3-25289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATG12 Antibody (NBP3-25289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG12 Products

Research Areas for ATG12 Antibody (NBP3-25289)

Find related products by research area.

Blogs on ATG12. Showing 1-10 of 16 blog posts - Show all blog posts.

Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis
By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit...  Read full blog post.


  Read full blog post.


  Read full blog post.

Animal Models to Study Autophagy
By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

ATG4C - A regulator of the early steps of autophagosome assembly
Autophagy is an important cellular process that maintains homeostasis by degrading and recycling damaged proteins and organelles. Autophagy receptors, such as p62/SQSTM1, recognize these intracellular cargo and mediate their engulfment by the doubl...  Read full blog post.

ATG16L2 - An autophagy-related protein with unknown functions
Autophagy is a process by which cells degrade and recycle damaged organelles or misfolded proteins. These various cargo are engulfed in a double-membrane structure called the autophagosome. The autophagosome then fuses with the lysosome to facilit...  Read full blog post.

ATG4D - A regulator of autophagy and apoptosis
Autophagy is an essential cellular process whereby damaged proteins and organelles are degraded and recycled. Autophagy, while happening constantly at a basal level, is tightly regulated and can be further induced under cellular stress. One of the ...  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and ...  Read full blog post.

Showing 1-10 of 16 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG12 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG12