ASC/TMS1 Antibody


Western Blot: ASC/TMS1 Antibody [NBP2-48925] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: ASC/TMS1 Antibody [NBP2-48925] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining in human spleen and skeletal muscle tissues using anti-PYCARD antibody. Corresponding PYCARD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human spleen shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ASC/TMS1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Specificity of human ASC/TMS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASC/TMS1 Recombinant Protein Antigen (NBP2-48925PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ASC/TMS1 Antibody

  • ASC
  • ASCMGC10332
  • CARD5
  • caspase recruitment domain protein 5
  • Caspase recruitment domain-containing protein 5
  • hASC
  • PYD and CARD domain containing
  • PYD and CARD domain-containing protein
  • Target of methylation-induced silencing 1
  • TMS1
  • TMS-1
  • TMS1apoptosis-associated speck-like protein containing a CARD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ASC/TMS1 Antibody (NBP2-48925) (0)

There are no publications for ASC/TMS1 Antibody (NBP2-48925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASC/TMS1 Antibody (NBP2-48925) (0)

There are no reviews for ASC/TMS1 Antibody (NBP2-48925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASC/TMS1 Antibody (NBP2-48925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ASC/TMS1 Antibody (NBP2-48925)

Discover related pathways, diseases and genes to ASC/TMS1 Antibody (NBP2-48925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASC/TMS1 Antibody (NBP2-48925)

Discover more about diseases related to ASC/TMS1 Antibody (NBP2-48925).

Pathways for ASC/TMS1 Antibody (NBP2-48925)

View related products by pathway.

PTMs for ASC/TMS1 Antibody (NBP2-48925)

Learn more about PTMs related to ASC/TMS1 Antibody (NBP2-48925).

Research Areas for ASC/TMS1 Antibody (NBP2-48925)

Find related products by research area.

Blogs on ASC/TMS1.

Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation
By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea...  Read full blog post.

CARD & NFKB Antibodies for Apoptosis Research
Apoptosis is one of the main types of programmed cell death which involves a cascade of biochemical events leading to specific cell morphology characteristics and ultimately death of cells.Caspases play crucial roles in modulating cellular signaling...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASC/TMS1 Antibody and receive a gift card or discount.


Gene Symbol PYCARD