ARMC3 Antibody

Images

 
Immunohistochemistry-Paraffin: ARMC3 Antibody [NBP2-32703] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARMC3 Protein (NBP2-32703PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMC3 Antibody

  • armadillo repeat containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-84175
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-32639
Species: Hu
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NBP1-87928
Species: Hu
Applications: IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88991
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81026
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32703
Species: Hu
Applications: IHC, IHC-P

Publications for ARMC3 Antibody (NBP2-32703) (0)

There are no publications for ARMC3 Antibody (NBP2-32703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMC3 Antibody (NBP2-32703) (0)

There are no reviews for ARMC3 Antibody (NBP2-32703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARMC3 Antibody (NBP2-32703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMC3 Products

Bioinformatics Tool for ARMC3 Antibody (NBP2-32703)

Discover related pathways, diseases and genes to ARMC3 Antibody (NBP2-32703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMC3 Antibody (NBP2-32703)

Discover more about diseases related to ARMC3 Antibody (NBP2-32703).
 

Pathways for ARMC3 Antibody (NBP2-32703)

View related products by pathway.

Blogs on ARMC3

There are no specific blogs for ARMC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC3