MS4A8B Antibody - BSA Free

Western Blot: MS4A8B Antibody [NBP1-81026] - Analysis in control (vector only transfected HEK293T lysate) and MS4A8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human prostate shows low positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human duodenum, fallopian tube, kidney and prostate using Anti-MS4A8B antibody NBP1-81026 (A) shows similar protein distribution across tissues to independent antibody NBP1-81025 (B).

Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human kidney shows low positivity in cells in tubules as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MS4A8B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MS4A8B Antibody - BSA Free (NBP1-81026) is a polyclonal antibody validated for use in IHC and WB. Anti-MS4A8B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MS4A8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MS4A8B Protein (NBP1-81026PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MS4A8B Antibody - BSA Free

• 4SPAN4
• Four-span transmembrane protein 4
• membrane-spanning 4-domains subfamily A member 8B
• membrane-spanning 4-domains, subfamily A, member 8B
• MS4A4
• MS4A8B

Background

Membrane-spanning 4-domains, subfamily A, member 8B (MS4A8B) is involved in signal transduction as a component of a multimeric receptor complex. MS4A8B is integral to membrane and receptor activity. The MS4A family has common structural features, similar intron/exon splice boundaries, and display unique expression patterns among hematopoietic cells and non-lymphoid tissues. MS4A8B is regulated by HNF4A and TGFB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MS4A8B Antibody (NBP1-81026)(1)

Publication using NBP1-81026

• Ye L, Yao XD, Wan FN et al. MS4A8B promotes cell proliferation in prostate cancer. Prostate. 2014-06-01 [PMID: 24789009] (IHC-P, WB, Human)

Bioinformatics

• Gene Symbol: MS4A8
• Entrez:
  • 83661(Human)
• Uniprot:
  • Q9BY19(Human)