Western Blot: MS4A8B Antibody [NBP1-81026] - Analysis in control (vector only transfected HEK293T lysate) and MS4A8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human prostate shows low positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human duodenum, fallopian tube, kidney and prostate using Anti-MS4A8B antibody NBP1-81026 (A) shows similar ...read more
Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: MS4A8B Antibody [NBP1-81026] - Staining of human kidney shows low positivity in cells in tubules as expected.
Novus Biologicals Rabbit MS4A8B Antibody - BSA Free (NBP1-81026) is a polyclonal antibody validated for use in IHC and WB. Anti-MS4A8B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for MS4A8B Antibody - BSA Free
4SPAN4
Four-span transmembrane protein 4
membrane-spanning 4-domains subfamily A member 8B
membrane-spanning 4-domains, subfamily A, member 8B
MS4A4
MS4A8B
Background
Membrane-spanning 4-domains, subfamily A, member 8B (MS4A8B) is involved in signal transduction as a component of a multimeric receptor complex. MS4A8B is integral to membrane and receptor activity. The MS4A family has common structural features, similar intron/exon splice boundaries, and display unique expression patterns among hematopoietic cells and non-lymphoid tissues. MS4A8B is regulated by HNF4A and TGFB1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MS4A8B Antibody - BSA Free and receive a gift card or discount.