ARMC4 Antibody

Images

 
Western Blot: ARMC4 Antibody [NBP1-84175] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - staining of human bronchus shows moderate positivity in ciliated cells of respiratory epithelia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARMC4 Protein (NBP1-84175PEP)
Publications
Read Publications using
NBP1-84175 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMC4 Antibody

  • armadillo repeat containing 4
  • armadillo repeat-containing protein 4
  • DKFZp434P1735
  • FLJ10376
  • FLJ10817
  • FLJ32798

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87928
Species: Hu
Applications: IHC, IHC-P
NBP1-88581
Species: Hu
Applications: IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-81989
Species: Hu
Applications: WB, IHC, IHC-P
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF921
Species: Hu
Applications: WB, IHC
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-32639
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81026
Species: Hu
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
H00064446-M01
Species: Hu, Ca
Applications: WB, ELISA, ICC/IF
NBP1-85394
Species: Hu
Applications: IHC, IHC-P

Publications for ARMC4 Antibody (NBP1-84175)(4)

Reviews for ARMC4 Antibody (NBP1-84175) (0)

There are no reviews for ARMC4 Antibody (NBP1-84175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMC4 Antibody (NBP1-84175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMC4 Products

Bioinformatics Tool for ARMC4 Antibody (NBP1-84175)

Discover related pathways, diseases and genes to ARMC4 Antibody (NBP1-84175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMC4 Antibody (NBP1-84175)

Discover more about diseases related to ARMC4 Antibody (NBP1-84175).
 

Pathways for ARMC4 Antibody (NBP1-84175)

View related products by pathway.

Blogs on ARMC4

There are no specific blogs for ARMC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC4
Entrez
Uniprot