ARMC4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - Analysis in human fallopian tube and stomach tissues. Corresponding ARMC4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - Staining of human stomach shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - Staining of human bronchus shows strong positivity in cilia of glandular cells.

Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - Staining of human fallopian tube shows moderate positivity in cilia of glandular cells.

Immunohistochemistry-Paraffin: ARMC4 Antibody [NBP1-84175] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARMC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARMC4 Antibody - BSA Free (NBP1-84175) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ARMC4 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARMC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARMC4 Protein (NBP1-84175PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARMC4 Antibody - BSA Free

• armadillo repeat containing 4
• armadillo repeat-containing protein 4
• DKFZp434P1735
• FLJ10376
• FLJ10817
• FLJ32798

Background

Researchers are still determining the function of ARMC4, also known as Armadillo repeat-containing protein 4, which consists of a 1,044 amino acid isoform that is 116 kDa. Current disease research is determining the relation between ARMC4 and Alzheimer's disease. It is unknown if the protein is linked to any pathways in the human body, but ARMC4 does interact with MAPK6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARMC4 Antibody (NBP1-84175)(4)

Publications using NBP1-84175

• Hjeij R, Onoufriadis A, Watson CM et al. CCDC151 Mutations Cause Primary Ciliary Dyskinesia by Disruption of the Outer Dynein Arm Docking Complex Formation. Am J Hum Genet 2014-09-04 [PMID: 25192045] (ICC/IF, Mouse)
• Onoufriadis A, Shoemark A, Munye MM et al. Combined exome and whole-genome sequencing identifies mutations in ARMC4 as a cause of primary ciliary dyskinesia with defects in the outer dynein arm. J Med Genet 2014-01-01 [PMID: 24203976]
• Hjeij R, Lindstrand A, Francis R et al. ARMC4 Mutations Cause Primary Ciliary Dyskinesia with Randomization of Left/Right Body Asymmetry. Am J Hum Genet 2013-08-08 [PMID: 23849778]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ARMC4
• Entrez:
  • 55130(Human)
• Uniprot:
  • Q5T2S8(Human)