WDR63 Antibody - BSA Free

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] - Analysis in human testis and skeletal muscle tissues using HPA038526 antibody. Corresponding WDR63 RNA-seq data are presented for the same tissues.

Western Blot: WDR63 Antibody [NBP2-32639] - Analysis in control (vector only transfected HEK293T lysate) and WDR63 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and strong membranous in Leydig cells.

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] -Staining of human bronchus shows moderate positivity in cilia in respiratory epithelial cells.

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] -Staining of human fallopian tube shows moderate positivity in cilia.

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] -Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR63 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WDR63 Antibody - BSA Free (NBP2-32639) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR63
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WDR63 Protein (NBP2-32639PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR63 Antibody - BSA Free

• FLJ30067
• NYD-SP29
• RP11-507C22.2
• testis development protein NYD-SP29 (NYD-SP29)
• Testis development protein NYD-SP29
• WD repeat domain 63
• WD repeat-containing protein 63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR63