WDR63 Antibody

Images

 
Western Blot: WDR63 Antibody [NBP2-32639] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: WDR63 Antibody [NBP2-32639] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and strong membranous in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR63 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR63 Protein (NBP2-32639PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR63 Antibody

  • FLJ30067
  • NYD-SP29
  • RP11-507C22.2
  • testis development protein NYD-SP29 (NYD-SP29)
  • Testis development protein NYD-SP29
  • WD repeat domain 63
  • WD repeat-containing protein 63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87928
Species: Hu
Applications: IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
9094-AG
Species: Hu
NBP1-84175
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81026
Species: Hu
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NBP1-85394
Species: Hu
Applications: IHC, IHC-P
H00064446-M01
Species: Hu, Ca
Applications: WB, ELISA, ICC/IF

Publications for WDR63 Antibody (NBP2-32639) (0)

There are no publications for WDR63 Antibody (NBP2-32639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR63 Antibody (NBP2-32639) (0)

There are no reviews for WDR63 Antibody (NBP2-32639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR63 Antibody (NBP2-32639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR63 Products

Bioinformatics Tool for WDR63 Antibody (NBP2-32639)

Discover related pathways, diseases and genes to WDR63 Antibody (NBP2-32639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDR63

There are no specific blogs for WDR63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR63