ARID2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARID2 Antibody [NBP2-57220] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARID2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARID2 Antibody - BSA Free (NBP2-57220) is a polyclonal antibody validated for use in ICC/IF. Anti-ARID2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARID2 Recombinant Protein Antigen (NBP2-57220PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARID2 Antibody - BSA Free

• ARID domain-containing protein 2
• AT rich interactive domain 2 (ARID, RFX-like)
• BAF200KIAA1557AT-rich interactive domain-containing protein 2
• BRG1-associated factor 200
• DKFZp686G052
• DKFZp779P0222
• FLJ30619
• p200
• Zinc finger protein with activation potential
• zipzap
• zipzap/p200

Background

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. SWI/SNF complexes possess ATPase and DNA helicase activity that promotes transcriptional activation of genes normally repressed by chromatin structure. ARID2 (AT-rich interactive domain-containing protein 2) is also known as BAF200 and was purified as a factor that associated with PBAF (hSWI/SNF-B). ARID2 is a noncatalytic subunit that is a member of the ARID (AT-rich interactive domain-containing protein) family of DNA binding proteins. In addition to the ARID domain, ARID2 also contains a C2H2-type zinc finger and has been implicated as a transcriptional co-activator for serum response factor for the regulation of cardiac genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARID2 Antibody (NBP2-57220)(1)

Publication using NBP2-57220

• Karki M, Jangid RK, Seervai RNH, Bertocchio JP A Cytoskeletal Function for PBRM1 Reading Methylated Microtubules Sci Adv 2021-04-03 [PMID: 33811077]

Bioinformatics

• Gene Symbol: ARID2