ARHGEF16 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGEF16 Antibody [NBP1-83372] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGEF16 Protein (NBP1-83372PEP)
Publications
Read Publication using NBP1-83372.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF16 Antibody

  • EPHEXIN4
  • ephexin-4
  • GEF16
  • NBRRho guanine exchange factor (GEF) 16
  • Rho guanine nucleotide exchange factor (GEF) 16
  • rho guanine nucleotide exchange factor 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79794
Species: Hu
Applications: WB, IHC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1396
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF4414
Species: Hu
Applications: WB, IHC
H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC

Publications for ARHGEF16 Antibody (NBP1-83372)(1)

Reviews for ARHGEF16 Antibody (NBP1-83372) (0)

There are no reviews for ARHGEF16 Antibody (NBP1-83372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGEF16 Antibody (NBP1-83372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF16 Products

Bioinformatics Tool for ARHGEF16 Antibody (NBP1-83372)

Discover related pathways, diseases and genes to ARHGEF16 Antibody (NBP1-83372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF16 Antibody (NBP1-83372)

Discover more about diseases related to ARHGEF16 Antibody (NBP1-83372).
 

Pathways for ARHGEF16 Antibody (NBP1-83372)

View related products by pathway.

PTMs for ARHGEF16 Antibody (NBP1-83372)

Learn more about PTMs related to ARHGEF16 Antibody (NBP1-83372).

Blogs on ARHGEF16

There are no specific blogs for ARHGEF16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF16
Entrez
Uniprot