DAZ1 Antibody (3G10)

Images

 
Western Blot: DAZ1 Antibody (3G10) [H00001617-M01] - DAZ1 monoclonal antibody (M01), clone 3G10. Analysis of DAZ1 expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.
Sandwich ELISA: DAZ1 Antibody (3G10) [H00001617-M01] - Detection limit for recombinant GST tagged DAZ1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DAZ1 Antibody (3G10) Summary

Immunogen
DAZ1 (AAH18119, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Specificity
DAZ1 - deleted in azoospermia 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DAZ1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAZ1 Antibody (3G10)

  • deleted in azoospermia 1
  • deleted in azoospermia
  • FLJ17175
  • SPGYDAZdeleted in azoospermia protein 1

Background

This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2437
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33538
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-88834
Species: Hu
Applications: WB
NBP1-80443
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NBP2-92850
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-79749
Species: Hu
Applications: WB
NBP1-98290
Species: Hu
Applications: WB
NBP2-16103
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP1-57481
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
22240002
Species: Hu
Applications: WB, ELISA
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for DAZ1 Antibody (H00001617-M01) (0)

There are no publications for DAZ1 Antibody (H00001617-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZ1 Antibody (H00001617-M01) (0)

There are no reviews for DAZ1 Antibody (H00001617-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAZ1 Antibody (H00001617-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DAZ1 Products

Array H00001617-M01

Bioinformatics Tool for DAZ1 Antibody (H00001617-M01)

Discover related pathways, diseases and genes to DAZ1 Antibody (H00001617-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZ1 Antibody (H00001617-M01)

Discover more about diseases related to DAZ1 Antibody (H00001617-M01).
 

Pathways for DAZ1 Antibody (H00001617-M01)

View related products by pathway.

PTMs for DAZ1 Antibody (H00001617-M01)

Learn more about PTMs related to DAZ1 Antibody (H00001617-M01).

Blogs on DAZ1

There are no specific blogs for DAZ1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAZ1 Antibody (3G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DAZ1
Entrez
OMIM
Uniprot