Argininosuccinate Lyase Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining in human liver and skeletal muscle tissues using NBP1-87462 antibody. Corresponding ASL RNA-seq data ...read more
Orthogonal Strategies: Western Blot: Argininosuccinate Lyase Antibody [NBP1-87462] - Analysis in human cell lines A-431 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Argininosuccinate Lyase Antibody [NBP1-87462] - Staining of human stomach shows weak cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Ca, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Argininosuccinate Lyase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24945279). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Argininosuccinate Lyase Recombinant Protein Antigen (NBP1-87462PEP)
Publications
Read Publications using
NBP1-87462 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Canine reactivity reported in scientific literature (PMID: 24945279).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Argininosuccinate Lyase Antibody

  • argininosuccinase
  • argininosuccinate lyase
  • arginosuccinase
  • ASAL
  • EC 4.3.2.1

Background

Argininosuccinate Lyase encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-1699
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-93763
Species: Hu, Mu, Rt
Applications: WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87462
Species: Hu, Ca, Mu
Applications: WB, IHC, IHC-P

Publications for Argininosuccinate Lyase Antibody (NBP1-87462)(2)

We have publications tested in 2 confirmed species: Mouse, Canine.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
Canine
(1)
All Species

Reviews for Argininosuccinate Lyase Antibody (NBP1-87462) (0)

There are no reviews for Argininosuccinate Lyase Antibody (NBP1-87462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argininosuccinate Lyase Antibody (NBP1-87462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Argininosuccinate Lyase Products

Bioinformatics Tool for Argininosuccinate Lyase Antibody (NBP1-87462)

Discover related pathways, diseases and genes to Argininosuccinate Lyase Antibody (NBP1-87462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Lyase Antibody (NBP1-87462)

Discover more about diseases related to Argininosuccinate Lyase Antibody (NBP1-87462).
 

Pathways for Argininosuccinate Lyase Antibody (NBP1-87462)

View related products by pathway.

PTMs for Argininosuccinate Lyase Antibody (NBP1-87462)

Learn more about PTMs related to Argininosuccinate Lyase Antibody (NBP1-87462).

Blogs on Argininosuccinate Lyase

There are no specific blogs for Argininosuccinate Lyase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Argininosuccinate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASL