ARHGAP11A Antibody

Images

 
Western Blot: ARHGAP11A Antibody [NBP1-93657] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP11A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGAP11A Protein (NBP1-93657PEP)
Publications
Read Publication using NBP1-93657.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%). Reactivity reported in scientific literature (PMID: 24596151)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP11A Antibody

  • GAP (1-12)
  • KIAA0013
  • MGC70740
  • Rho GTPase activating protein 11A
  • rho GTPase-activating protein 11A
  • rho-type GTPase-activating protein 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-97725
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NLS1338
Species: Hu, Pm
Applications: IHC, IHC-P
NB400-139
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF6695
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
5190-GR
Species: Hu
Applications: BA
NBP1-80090
Species: Hu
Applications: WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NB100-1354
Species: Hu
Applications: Flow, IF, PEP-ELISA
H00004212-M01
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-04984
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-59254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-26549
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-52375
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF3416
Species: Hu
Applications: WB
NBP2-38172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
NLS932
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB

Publications for ARHGAP11A Antibody (NBP1-93657)(1)

Reviews for ARHGAP11A Antibody (NBP1-93657) (0)

There are no reviews for ARHGAP11A Antibody (NBP1-93657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP11A Antibody (NBP1-93657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGAP11A Products

Bioinformatics Tool for ARHGAP11A Antibody (NBP1-93657)

Discover related pathways, diseases and genes to ARHGAP11A Antibody (NBP1-93657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP11A Antibody (NBP1-93657)

Discover more about diseases related to ARHGAP11A Antibody (NBP1-93657).
 

Pathways for ARHGAP11A Antibody (NBP1-93657)

View related products by pathway.

Blogs on ARHGAP11A

There are no specific blogs for ARHGAP11A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP11A
Entrez
Uniprot