ARHGAP11A Antibody - BSA Free

Western Blot: ARHGAP11A Antibody [NBP1-93657] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: ARHGAP11A Antibody [NBP1-93657] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP11A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP11A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARHGAP11A Protein (NBP1-93657PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%). Reactivity reported in scientific literature (PMID: 24596151)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP11A Antibody - BSA Free

• GAP (1-12)
• KIAA0013
• MGC70740
• Rho GTPase activating protein 11A
• rho GTPase-activating protein 11A
• rho-type GTPase-activating protein 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP11A Antibody (NBP1-93657)(3)

Publications using NBP1-93657

• Fei H, Shi X, Sun D et Al. Integrated analysis identified the role of three family members of ARHGAP in pancreatic adenocarcinoma Sci Rep 2024-05-23 [PMID: 38783033]
• Chen S, Duan H, Xie Y et al. Expression and prognostic analysis of Rho GTPase-activating protein 11A in lung adenocarcinoma Annals of Translational Medicine 2021-06-24 [PMID: 34164506]
• Ly T, Ahmad Y, Shlien A et al. A proteomic chronology of gene expression through the cell cycle in human myeloid leukemia cells. eLife 2014-01-01 [PMID: 24596151]

Bioinformatics

• Gene Symbol: ARHGAP11A
• Entrez:
  • 9824(Human)
• Uniprot:
  • Q6P4F7(Human)