![Immunocytochemistry/Immunofluorescence: ZNF259 Antibody [NBP2-38172] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ZNF259-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38172-img0006.jpg "Immunocytochemistry/Immunofluorescence: ZNF259 Antibody [NBP2-38172] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZPR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 lysates, separated by Size, antibody dilution of 1:25. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZNF259 Antibody [NBP2-38172] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/ZNF259-Antibody-Immunohistochemistry-Paraffin-NBP2-38172-img0005.jpg "Immunohistochemistry-Paraffin: ZNF259 Antibody [NBP2-38172] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.")
![Simple Western: ZNF259 Antibody [NBP2-38172] - Simple Western lane view shows a specific band for ZNF259 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/ZNF259-Antibody-Simple-Western-NBP2-38172-img0003.jpg "Simple Western: ZNF259 Antibody [NBP2-38172] - Simple Western lane view shows a specific band for ZNF259 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: ZNF259 Antibody [NBP2-38172] - Electropherogram image of the corresponding Simple Western lane view. ZNF259 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.](http://images.novusbio.com/fullsize/ZNF259-Antibody-Simple-Western-NBP2-38172-img0004.jpg "Simple Western: ZNF259 Antibody [NBP2-38172] - Electropherogram image of the corresponding Simple Western lane view. ZNF259 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/PLA2G7_DPLG70_ELISA_161.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/DATA_PLA2G7_DPLG70_ELISA_794.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")