ZNF259 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF259 Antibody [NBP2-38172] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF259 Antibody [NBP2-38172] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Simple Western: ZNF259 Antibody [NBP2-38172] - Simple Western lane view shows a specific band for ZNF259 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: ZNF259 Antibody [NBP2-38172] - Electropherogram image of the corresponding Simple Western lane view. ZNF259 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF259 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF259 Antibody - BSA Free (NBP2-38172) is a polyclonal antibody validated for use in IHC, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZPR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:25
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 lysates, separated by Size, antibody dilution of 1:25. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  ZNF259 Protein (NBP2-38172PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF259 Antibody - BSA Free

• ERP1
• EZFIT-related protein 1
• KIAA1396MGC150657
• MGC150658
• Z1971
• zinc finger protein 471

Background

ZNF259 may be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZPR1
• Uniprot:
  • O75312(Human)