Connexin 36/GJD2 Antibody

Images

 
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in ...read more
Immunohistochemistry-Frozen: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody ...read more
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Connexin 36/GJD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%), Zebrafish (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:1000
  • Immunohistochemistry-Frozen 1:1000
  • Immunohistochemistry-Paraffin
Application Notes
This Connexin 36/GJA9 antibody is useful for Western blot and Immunohistochemistry-Frozen applications. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25197082). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 30412665).
Publications
Read Publications using
NBP1-59254 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Connexin 36/GJD2 Antibody

  • Connexin 36
  • Connexin-36
  • CX36
  • CX36connexin 36
  • Gap junction alpha-9 protein
  • gap junction delta-2 protein
  • gap junction protein, alpha 9, 36kDa
  • gap junction protein, delta 2, 36kDa
  • GJA9connexin-36
  • GJD2
  • MGC138315
  • MGC138319

Background

GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41304
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP2-68799
Species: Hu
Applications: IHC, IHC-P
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59160
Species: Hu
Applications: WB
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000761-M02
Species: Hu, Mu
Applications: WB, ELISA, Func, IHC, IHC-P, S-ELISA
NBP1-59254
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Connexin 36/GJD2 Antibody (NBP1-59254)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Reviews for Connexin 36/GJD2 Antibody (NBP1-59254) (0)

There are no reviews for Connexin 36/GJD2 Antibody (NBP1-59254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Connexin 36/GJD2 Antibody (NBP1-59254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Connexin 36/GJD2 Products

Bioinformatics Tool for Connexin 36/GJD2 Antibody (NBP1-59254)

Discover related pathways, diseases and genes to Connexin 36/GJD2 Antibody (NBP1-59254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 36/GJD2 Antibody (NBP1-59254)

Discover more about diseases related to Connexin 36/GJD2 Antibody (NBP1-59254).
 

Pathways for Connexin 36/GJD2 Antibody (NBP1-59254)

View related products by pathway.

PTMs for Connexin 36/GJD2 Antibody (NBP1-59254)

Learn more about PTMs related to Connexin 36/GJD2 Antibody (NBP1-59254).

Blogs on Connexin 36/GJD2

There are no specific blogs for Connexin 36/GJD2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Connexin 36/GJD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GJD2
Uniprot