Connexin 36/GJD2 Antibody - BSA Free

Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.

Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Connexin 36/GJD2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000
  • Immunohistochemistry-Frozen 1:1000
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25197082). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 30412665).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Connexin 36/GJD2 Antibody - BSA Free

• Connexin 36
• Connexin-36
• CX36
• CX36connexin 36
• Gap junction alpha-9 protein
• gap junction delta-2 protein
• gap junction protein, alpha 9, 36kDa
• gap junction protein, delta 2, 36kDa
• GJA9connexin-36
• GJD2
• MGC138315
• MGC138319

Background

GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Connexin 36/GJD2 Antibody (NBP1-59254)(3)

Publications using NBP1-59254

• Hitoshi Iida, Tatsuyoshi Kono, Chih-Chun Lee, Preethi Krishnan, Matthew C. Arvin, Staci A. Weaver, Timothy S. Jarvela, Renato C. S. Branco, Madeline R. McLaughlin, Robert N. Bone, Xin Tong, Peter Arvan, Iris Lindberg, Carmella Evans-Molina SERCA2 regulates proinsulin processing and processing enzyme maturation in pancreatic beta cells Diabetologia 2023-08-04 [PMID: 37537395]
• Farnsworth NL, Walter R, Piscopio RA et al. Exendin-4 overcomes cytokine-induced decreases in gap junction coupling via protein kinase A and Epac2 in mouse and human islets. J. Physiol. (Lond.). 2018-11-09 [PMID: 30412665] (ICC/IF, Mouse, Human)
• Moore AR, Zhou WL, Sirois CL et al. Connexin hemichannels contribute to spontaneous electrical activity in the human fetal cortex. Proc. Natl. Acad. Sci. U.S.A. 2014-09-16 [PMID: 25197082] (IHC-P, Human)

Bioinformatics

• Gene Symbol: GJD2
• Uniprot:
  • Q9UKL4(Human)