ARG2 Antibody

Images

 
Immunohistochemistry-Paraffin: ARG2 Antibody [NBP1-86189] - Analysis in control (vector only transfected HEK293T lysate) and aRG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: ARG2 Antibody [NBP1-86189] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARG2 Protein (NBP1-86189PEP)
Publications
Read Publications using NBP1-86189.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%). Reactivity reported in scientific literature (PMID: 23183942)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARG2 Antibody

  • arginase 2
  • arginase, type II
  • arginase-2, mitochondrial
  • EC 3.5.3
  • EC 3.5.3.1
  • kidney arginase
  • Kidney-type arginase
  • L-arginine amidinohydrolase
  • L-arginine ureahydrolase
  • nonhepatic arginase
  • Non-hepatic arginase
  • Type II arginase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7185
Species: Hu
Applications: WB, Simple Western
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86189
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARG2 Antibody (NBP1-86189)(3)

Reviews for ARG2 Antibody (NBP1-86189) (0)

There are no reviews for ARG2 Antibody (NBP1-86189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARG2 Antibody (NBP1-86189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARG2 Products

Bioinformatics Tool for ARG2 Antibody (NBP1-86189)

Discover related pathways, diseases and genes to ARG2 Antibody (NBP1-86189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARG2 Antibody (NBP1-86189)

Discover more about diseases related to ARG2 Antibody (NBP1-86189).
 

Pathways for ARG2 Antibody (NBP1-86189)

View related products by pathway.

PTMs for ARG2 Antibody (NBP1-86189)

Learn more about PTMs related to ARG2 Antibody (NBP1-86189).
 

Research Areas for ARG2 Antibody (NBP1-86189)

Find related products by research area.

Blogs on ARG2

There are no specific blogs for ARG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARG2
Entrez
Uniprot