ARG2 Antibody - BSA Free

Immunohistochemistry analysis in human prostate and fallopian tube tissues using HPA000663 antibody. Corresponding ARG2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ARG2 Antibody [NBP1-86189] - Staining of human prostate shows high expression.

Staining of human fallopian tube shows no positivity in glandular cells as expected.

Staining of human gastrointestinal shows moderate cytoplasm granular positivity in glandular cells.

Staining of human kidney shows strong cytoplasm granular positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARG2 Antibody - BSA Free (NBP1-86189) is a polyclonal antibody validated for use in IHC. Anti-ARG2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHAD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARG2 Protein (NBP1-86189PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%). Reactivity reported in scientific literature (PMID: 23183942)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARG2 Antibody - BSA Free

• ARG2
• Arginase 2
• arginase, type II
• Arginase-2
• arginase-2, mitochondrial
• EC 3.5.3
• EC 3.5.3.1
• kidney arginase
• Kidney-type arginase
• L-arginine amidinohydrolase
• L-arginine ureahydrolase
• nonhepatic arginase
• Non-hepatic arginase
• Type II Arginase

Background

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARG2 Antibody (NBP1-86189)(3)

Publications using NBP1-86189

• Shemyakin A, Kovamees O, Rafnsson A et al. Arginase inhibition improves endothelial function in patients with coronary artery disease and type 2 diabetes mellitus. Circulation 2012-12-18 [PMID: 23183942]
• Gonon AT, Jung C, Katz A et al. Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production. PLoS One 2012-01-01 [PMID: 22860052]
• Gronros J, Jung C, Lundberg JO et al. Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats. Am J Physiol Heart Circ Physiol 2011-04-01 [PMID: 21297024]

Bioinformatics

• Gene Symbol: ARG2
• Entrez:
  • 384(Human)
• Uniprot:
  • P78540()