Apolipoprotein D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Apolipoprotein D Antibody [NBP2-57684] - Staining of human cell line ASC TERT1 shows localization to plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684] - Staining in human breast and colon tissues using anti-APOD antibody. Corresponding APOD RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: Apolipoprotein D Antibody [NBP2-57684] - Staining of human colon shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Apolipoprotein D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE
Specificity
Specificity of human Apolipoprotein D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Apolipoprotein D Recombinant Protein Antigen (NBP2-57684PEP)

Reactivity Notes

Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Apolipoprotein D Antibody

  • ApoD
  • apo-D
  • apolipoprotein D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2751
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IP
H00010380-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-609
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57684
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Apolipoprotein D Antibody (NBP2-57684) (0)

There are no publications for Apolipoprotein D Antibody (NBP2-57684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein D Antibody (NBP2-57684) (0)

There are no reviews for Apolipoprotein D Antibody (NBP2-57684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Apolipoprotein D Antibody (NBP2-57684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Apolipoprotein D Antibody (NBP2-57684)

Discover related pathways, diseases and genes to Apolipoprotein D Antibody (NBP2-57684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein D Antibody (NBP2-57684)

Discover more about diseases related to Apolipoprotein D Antibody (NBP2-57684).
 

Pathways for Apolipoprotein D Antibody (NBP2-57684)

View related products by pathway.

PTMs for Apolipoprotein D Antibody (NBP2-57684)

Learn more about PTMs related to Apolipoprotein D Antibody (NBP2-57684).

Blogs on Apolipoprotein D

There are no specific blogs for Apolipoprotein D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOD