Apolipoprotein A-IV/ApoA4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: APOA4 Antibody [NBP1-86179] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: APOA4 Antibody [NBP1-86179] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apolipoprotein A-IV/ApoA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Apolipoprotein A-IV/ApoA4 Protein (NBP1-86179PEP)
Publications
Read Publications using NBP1-86179.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Apolipoprotein A-IV/ApoA4 Antibody

  • apo-AIV
  • apoA-IV
  • Apolipoprotein A4
  • Apolipoprotein AIV
  • Apolipoprotein A-IV
  • MGC142154
  • MGC142156

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-57716
Species: Hu
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
AF4497
Species: Hu
Applications: WB, Simple Western
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
AF4409
Species: Mu
Applications: WB
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-62539
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86179
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)(2)

Reviews for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179) (0)

There are no reviews for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179). (Showing 1 - 1 of 1 FAQs).

  1. I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?
    • All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein A-IV/ApoA4 Products

Bioinformatics Tool for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)

Discover related pathways, diseases and genes to Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)

Discover more about diseases related to Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179).
 

Pathways for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)

View related products by pathway.

PTMs for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)

Learn more about PTMs related to Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179).
 

Research Areas for Apolipoprotein A-IV/ApoA4 Antibody (NBP1-86179)

Find related products by research area.

Blogs on Apolipoprotein A-IV/ApoA4

There are no specific blogs for Apolipoprotein A-IV/ApoA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein A-IV/ApoA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA4
Entrez