ANP32B Antibody (4A8E5)

Western Blot: ANP32B Antibody (4A8E5) [NBP3-16199] - Western blot analysis of extracts of various cell lines, using ANP32B Rabbit mAb (NBP3-16199) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded rat liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of HeLa cells using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of C6 cells using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded rat lung tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human thyroid tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded human esophagus tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded mouse liver tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of paraffin-embedded Mouse colon tissue using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: ANP32B Antibody (4A8E5) [NBP3-16199] - Immunohistochemistry analysis of ANP32B in paraffin-embedded mouse heart tissue using ANP32B Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ANP32B Antibody (4A8E5) [NBP3-16199] - Confocal imaging of NIH/3T3 cells using ANP32B Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4A8E5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ANP32B Antibody (4A8E5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ANP32B (Q92688). MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ANP32B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ANP32B Antibody (4A8E5)

• acidic (leucine-rich) nuclear phosphoprotein 32 family, member B
• acidic leucine-rich nuclear phosphoprotein 32 family member B
• Acidic protein rich in leucines
• APRILSilver-stainable protein SSP29
• Pal31
• PHAPI2SSP29
• Putative HLA-DR-associated protein I-2

Background

Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANP32B