Annexin A3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Annexin A3 Antibody [NBP1-90155] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Annexin A3 Antibody [NBP1-90155] - Analysis in human bone marrow and testis tissues using NBP1-90155 antibody. Corresponding ANXA3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Annexin A3 Antibody [NBP1-90155] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: Annexin A3 Antibody [NBP1-90155] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Analysis in human cell lines A-431 and HEK293 using Anti-ANXA3 antibody. Corresponding ANXA3 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western blot analyses of ANXA3, CMBL & S100A13 expression.Depleted cyst fluids from cPTCs & benign lesions are shown together with total protein extract from A549 cells. Protein sizes are indicated to the right in kDa. Ponceau S solution used as loading control is shown below. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0126472), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Annexin A3 Antibody - BSA Free (NBP1-90155) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Annexin A3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTD
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Annexin A3 Protein (NBP1-90155PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A3 Antibody - BSA Free

• 35-alpha calcimedin
• Annexin A3
• annexin A3,1,2-cyclic-inositol-phosphate phosphodiesterase
• Annexin III
• annexin-3
• ANXA3
• Calcimedin 35-alpha
• calcimedin 35-alpha
• Lipocortin III
• PAP-III
• Placental anticoagulant protein III
• placental anticoagulant protein III, calcimedin 35-alpha

Background

Annexin A3 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Annexin A3 Antibody (NBP1-90155)(2)

Publications using NBP1-90155

• de Klerk E, Xiao Y, Emfinger CH et al. Loss of ZNF148 enhances insulin secretion in human pancreatic ? cells JCI insight 2023-06-08 [PMID: 37288664] (IHC-P, Human)
  
  Details:
  1:500 IHC-P dilution
• Dinets A, Pernemalm M, Kjellin H et al. Differential Protein Expression Profiles of Cyst Fluid from Papillary Thyroid Carcinoma and Benign Thyroid Lesions. PLoS One. 2015-05-15 [PMID: 25978681] (IF/IHC, WB, Human)

Bioinformatics

• Gene Symbol: ANXA3