Annexin A3 Antibody

Images

 
Western Blot: Annexin A3 Antibody [NBP1-90154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Annexin A3 Antibody [NBP1-90154] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Annexin A3 Antibody [NBP1-90154] - Staining of human prostate shows strong positivity in glandular cells.
Western Blot: Annexin A3 Antibody [NBP1-90154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Annexin A3 Protein (NBP1-90154PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A3 Antibody

  • 35-alpha calcimedin
  • Annexin A3
  • annexin A3,1,2-cyclic-inositol-phosphate phosphodiesterase
  • Annexin III
  • annexin-3
  • ANXA3
  • Calcimedin 35-alpha
  • calcimedin 35-alpha
  • Lipocortin III
  • PAP-III
  • Placental anticoagulant protein III
  • placental anticoagulant protein III, calcimedin 35-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Annexin A3 Antibody (NBP1-90154) (0)

There are no publications for Annexin A3 Antibody (NBP1-90154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A3 Antibody (NBP1-90154) (0)

There are no reviews for Annexin A3 Antibody (NBP1-90154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A3 Antibody (NBP1-90154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A3 Products

Bioinformatics Tool for Annexin A3 Antibody (NBP1-90154)

Discover related pathways, diseases and genes to Annexin A3 Antibody (NBP1-90154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A3 Antibody (NBP1-90154)

Discover more about diseases related to Annexin A3 Antibody (NBP1-90154).
 

Pathways for Annexin A3 Antibody (NBP1-90154)

View related products by pathway.

PTMs for Annexin A3 Antibody (NBP1-90154)

Learn more about PTMs related to Annexin A3 Antibody (NBP1-90154).

Blogs on Annexin A3

There are no specific blogs for Annexin A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA3
Entrez