ANKRD26 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD26 Antibody [NBP1-82937] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ANKRD26 Antibody [NBP1-82937] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD26 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQLKKLMELKQSLECNLDQEMKKNVELEREITGFKNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD26 Protein (NBP1-82937PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD26 Antibody

  • ankyrin repeat domain 26
  • ankyrin repeat domain-containing protein 26
  • bA145E8.1
  • KIAA1074MGC163325

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00317754-Q01
Species: Hu
NBP2-14457
Species: Hu
Applications: IHC, IHC-P
NBP2-14970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2307
Species: Hu
Applications: WB
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85145
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for ANKRD26 Antibody (NBP1-82937) (0)

There are no publications for ANKRD26 Antibody (NBP1-82937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD26 Antibody (NBP1-82937) (0)

There are no reviews for ANKRD26 Antibody (NBP1-82937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD26 Antibody (NBP1-82937). (Showing 1 - 1 of 1 FAQ).

  1. Is the antibody code. NBP1-82937 suitable for whole blood samples?
    • Our ANKRD26 antibody with catalogue number NBP1-82937 has been validated for IHC with paraffin-embedded human tissue samples, and it has also been validated for immunofluorescence; other species and applications have not yet been tested. The immunocytochemistry application was validated using plated A-431 cells, which are an adherent epidermoid carcinoma line. We do not routinely test our antibodies with samples of whole blood, and unfortunately we have no testing data to confirm whether this particular antibody would work in such an experimental set up. Should you be analysing your whole blood samples by flow cytometry, please note that NBP1-82937 has not yet been tested for flow.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD26 Products

Bioinformatics Tool for ANKRD26 Antibody (NBP1-82937)

Discover related pathways, diseases and genes to ANKRD26 Antibody (NBP1-82937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD26 Antibody (NBP1-82937)

Discover more about diseases related to ANKRD26 Antibody (NBP1-82937).
 

Pathways for ANKRD26 Antibody (NBP1-82937)

View related products by pathway.

PTMs for ANKRD26 Antibody (NBP1-82937)

Learn more about PTMs related to ANKRD26 Antibody (NBP1-82937).

Blogs on ANKRD26

There are no specific blogs for ANKRD26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD26