Recombinant Human CCDC85B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CCDC85B GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human CCDC85B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CCDC85B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCDC85B GST (N-Term) Protein

  • coiled-coil domain containing 85B
  • coiled-coil domain-containing protein 85B
  • DIPADelta-interacting protein A
  • hepatitis delta antigen interacting protein A
  • Hepatitis delta antigen-interacting protein A

Background

Hepatitis delta virus (HDV) is a pathogenic human virus whose RNA genome and replication cycle resemble those of plant viroids. Delta-interacting protein A (DIPA), a cellular gene product, has been found to have homology to hepatitis delta virus antigen (HDAg). DIPA interacts with the viral antigen, HDAg, and can affect HDV replication in vitro. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010445-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP2-14970
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NBP2-14119
Species: Hu
Applications: IHC, IHC-P
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NB100-79781
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-16628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for CCDC85B Partial Recombinant Protein (H00011007-Q01) (0)

There are no publications for CCDC85B Partial Recombinant Protein (H00011007-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC85B Partial Recombinant Protein (H00011007-Q01) (0)

There are no reviews for CCDC85B Partial Recombinant Protein (H00011007-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC85B Partial Recombinant Protein (H00011007-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCDC85B Products

Array H00011007-Q01

Bioinformatics Tool for CCDC85B Partial Recombinant Protein (H00011007-Q01)

Discover related pathways, diseases and genes to CCDC85B Partial Recombinant Protein (H00011007-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC85B Partial Recombinant Protein (H00011007-Q01)

Discover more about diseases related to CCDC85B Partial Recombinant Protein (H00011007-Q01).
 

Pathways for CCDC85B Partial Recombinant Protein (H00011007-Q01)

View related products by pathway.

Blogs on CCDC85B

There are no specific blogs for CCDC85B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCDC85B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC85B