ANKRD26 Antibody - BSA Free

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD26 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHDRDQSETSKRELELAFQRARDECSRLQDKMNFDVSNLKDNNEILSQQLFKTESKLNSLEIEFHHT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ANKRD26 Protein (NBP1-82936PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ANKRD26 Antibody - BSA Free

• ankyrin repeat domain 26
• ankyrin repeat domain-containing protein 26
• bA145E8.1
• KIAA1074MGC163325

Background

The ANKRD26 (ankyrin repeat domain 26) gene has been implicated to give rise to the POTE gene family which encode proteins containing ankyrin repeats and coiled -coil domains. The generation of mice that bear mutant AKFRD26 indicates that ANKRD26 plays a role in obesity, insulin resistance, and body size. ANKRD26 is also known as KIAA1074. Yes-associated protein 1 (YAP1) is the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [from NCBI GeneID:10413]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD26
• Entrez:
  • 22852(Human)
• Uniprot:
  • Q9UPS8(Human)