ANKRD26 Antibody

Images

 
Immunohistochemistry-Paraffin: ANKRD26 Antibody [NBP1-82936] - Staining of human appendix shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD26 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IHDRDQSETSKRELELAFQRARDECSRLQDKMNFDVSNLKDNNEILSQQLFKTESKLNSLEIEFHHT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD26 Protein (NBP1-82936PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD26 Antibody

  • ankyrin repeat domain 26
  • ankyrin repeat domain-containing protein 26
  • bA145E8.1
  • KIAA1074MGC163325

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00317754-M05-100ug
Species: Hu
Applications: ELISA, WB
H00011007-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-14970
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NBP1-31733
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-83680
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DTSP10
Species: Hu
Applications: ELISA
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-85146
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1544
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82936
Species: Hu
Applications: IHC, IHC-P

Publications for ANKRD26 Antibody (NBP1-82936) (0)

There are no publications for ANKRD26 Antibody (NBP1-82936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD26 Antibody (NBP1-82936) (0)

There are no reviews for ANKRD26 Antibody (NBP1-82936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKRD26 Antibody (NBP1-82936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD26 Products

Bioinformatics Tool for ANKRD26 Antibody (NBP1-82936)

Discover related pathways, diseases and genes to ANKRD26 Antibody (NBP1-82936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD26 Antibody (NBP1-82936)

Discover more about diseases related to ANKRD26 Antibody (NBP1-82936).
 

Pathways for ANKRD26 Antibody (NBP1-82936)

View related products by pathway.

PTMs for ANKRD26 Antibody (NBP1-82936)

Learn more about PTMs related to ANKRD26 Antibody (NBP1-82936).

Blogs on ANKRD26.

Eat responsibly: Epigenetic downregulation of Ankrd26 gene by long-term high-fat intake promotes obesity and inflammation
By Jamshed Arslan Pharm.D. White adipose tissue (WAT) represents the primary site to store energy in humans. WAT’s endocrine regulation of energy balance is controlled by nutritional status, exercise, and hormones l...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD26
Entrez
Uniprot