Androgen R/NR3C4 Recombinant Protein Antigen

Images

 
There are currently no images for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Androgen R/NR3C4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Androgen R/NR3C4.

Source: E. coli

Amino Acid Sequence: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55999.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Androgen R/NR3C4 Recombinant Protein Antigen

  • AIS
  • Androgen R
  • androgen receptor
  • AndrogenR
  • AR
  • DHTR
  • DHTRTFM
  • Dihydrotestosterone receptorHYSP1
  • HUMARA
  • NR3C4
  • NR3C4KD
  • Nuclear receptor subfamily 3 group C member 4
  • SBMA
  • SMAX1
  • SMAX1SBMA
  • spinal and bulbar muscular atrophy

Background

Androgens have a broad range of effects on the appearance and maintenance of male secondary sexual characteristics. Like other members of the steroid superfamily, the androgen receptor (AR) consists of an amino terminal modulating domain, a central DNA binding domain, a hinge region and a carboxy terminal ligand binding domain. The androgen receptor (AR) is a 110 kDa androgen-dependent transcription factor that is a member of the steroid/nuclear receptor gene superfamily. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis. AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy's disease and male infertility. The PI3K/Akt signaling pathway plays an important role in regulating AR activity through phosphorylation of AR at Ser213/210 and Ser791/790. Growth factors or cytokines may induce phosphorylation of AR through the PI3K/Akt pathway. Activation of the PI3K/AKt pathway is thought to have a survival role in prostate cancer by protecting cells from apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-305
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-90233
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP) (0)

There are no publications for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP) (0)

There are no reviews for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Androgen R/NR3C4 Products

Research Areas for Androgen R/NR3C4 Recombinant Protein Antigen (NBP2-55999PEP)

Find related products by research area.

Blogs on Androgen R/NR3C4

There are no specific blogs for Androgen R/NR3C4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Androgen R/NR3C4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AR