AMPK beta 1 Antibody (3H12-1A10)

Images

 
Western Blot: AMPK beta 1 Antibody (3H12-1A10) [H00005564-M01] - Analysis of PRKAB1 expression in transfected 293T cell line by PRKAB1 monoclonal antibody (M01), clone 3H12-1A10.Lane 1: PRKAB1 transfected lysate(31.05 ...read more
Sandwich ELISA: AMPK beta 1 Antibody (3H12-1A10) [H00005564-M01] - Detection limit for recombinant GST tagged PRKAB1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H12-1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AMPK beta 1 Antibody (3H12-1A10) Summary

Immunogen
PRKAB1 (AAH01007, 1 a.a. - 270 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Specificity
PRKAB1 - protein kinase, AMP-activated, beta 1 non-catalytic subunit
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKAB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPK beta 1 Antibody (3H12-1A10)

  • 5'-AMP-activated protein kinase beta-1 subunit
  • AMP-activated protein kinase beta subunit
  • AMPK beta -1 chain
  • AMPK beta 1
  • AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1
  • AMPK subunit beta-1
  • AMPK
  • AMPKb
  • HAMPKb
  • MGC17785
  • PRKAB1
  • protein kinase, AMP-activated, beta 1 non-catalytic subunit
  • protein kinase, AMP-activated, noncatalytic, beta-1

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005564-M01
Species: Hu
Applications: WB, ELISA

Publications for AMPK beta 1 Antibody (H00005564-M01) (0)

There are no publications for AMPK beta 1 Antibody (H00005564-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK beta 1 Antibody (H00005564-M01) (0)

There are no reviews for AMPK beta 1 Antibody (H00005564-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK beta 1 Antibody (H00005564-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK beta 1 Products

Bioinformatics Tool for AMPK beta 1 Antibody (H00005564-M01)

Discover related pathways, diseases and genes to AMPK beta 1 Antibody (H00005564-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK beta 1 Antibody (H00005564-M01)

Discover more about diseases related to AMPK beta 1 Antibody (H00005564-M01).
 

Pathways for AMPK beta 1 Antibody (H00005564-M01)

View related products by pathway.

PTMs for AMPK beta 1 Antibody (H00005564-M01)

Learn more about PTMs related to AMPK beta 1 Antibody (H00005564-M01).
 

Research Areas for AMPK beta 1 Antibody (H00005564-M01)

Find related products by research area.

Blogs on AMPK beta 1

There are no specific blogs for AMPK beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPK beta 1 Antibody (3H12-1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAB1
Entrez
OMIM
Uniprot