AMPK beta 1 Antibody (3H12-1A10) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
PRKAB1 (AAH01007, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI |
| Specificity |
PRKAB1 - protein kinase, AMP-activated, beta 1 non-catalytic subunit |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PRKAB1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for AMPK beta 1 Antibody (3H12-1A10) - Azide and BSA Free
Background
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA
Publications for AMPK beta 1 Antibody (H00005564-M01) (0)
There are no publications for AMPK beta 1 Antibody (H00005564-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AMPK beta 1 Antibody (H00005564-M01) (0)
There are no reviews for AMPK beta 1 Antibody (H00005564-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AMPK beta 1 Antibody (H00005564-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AMPK beta 1 Products
Research Areas for AMPK beta 1 Antibody (H00005564-M01)
Find related products by research area.
|
Blogs on AMPK beta 1