Recombinant Human AMPK alpha 2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human AMPK alpha 2 Protein [H00005563-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human AMPK alpha 2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 453-552 of Human AMPK alpha 2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRKAA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AMPK alpha 2 GST (N-Term) Protein

  • 5'-AMP-activated protein kinase catalytic subunit alpha-2
  • AMPK alpha 2
  • AMPK subunit alpha-2
  • AMPK2
  • AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain
  • AMPK-alpha-2 chain
  • EC 2.7.11
  • EC 2.7.11.1
  • PRKAA
  • PRKAA2
  • protein kinase, AMP-activated, alpha 2 catalytic subunit

Background

PRKAA2 - protein kinase, AMP-activated, alpha 2 catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
D6050
Species: Hu
Applications: ELISA
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005563-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01) (0)

There are no publications for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01) (0)

There are no reviews for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMPK alpha 2 Products

Bioinformatics Tool for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01)

Discover related pathways, diseases and genes to AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01)

Discover more about diseases related to AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01).
 

Pathways for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01)

View related products by pathway.

PTMs for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01)

Learn more about PTMs related to AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01).
 

Research Areas for AMPK alpha 2 Partial Recombinant Protein (H00005563-Q01)

Find related products by research area.

Blogs on AMPK alpha 2.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AMPK alpha 2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAA2