AMPK alpha 1 Antibody


Western Blot: AMPK alpha 1 Antibody [NBP2-49430] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry: AMPK alpha 1 Antibody [NBP2-49430] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

AMPK alpha 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
Specificity of human AMPK alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AMPK alpha 1 Recombinant Protein Antigen (NBP2-49430PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AMPK alpha 1 Antibody

  • AMP -activate kinase alpha 1 subunit
  • AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1
  • AMPK alpha 1
  • AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain
  • AMPK subunit alpha-1
  • AMPK
  • AMPK1
  • AMPKa1
  • EC 2.7.11
  • EC
  • MGC33776
  • MGC57364
  • PRKAA1
  • protein kinase, AMP-activated, alpha 1 catalytic subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for AMPK alpha 1 Antibody (NBP2-49430) (0)

There are no publications for AMPK alpha 1 Antibody (NBP2-49430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 1 Antibody (NBP2-49430) (0)

There are no reviews for AMPK alpha 1 Antibody (NBP2-49430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK alpha 1 Antibody (NBP2-49430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for AMPK alpha 1 Antibody (NBP2-49430)

Discover related pathways, diseases and genes to AMPK alpha 1 Antibody (NBP2-49430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK alpha 1 Antibody (NBP2-49430)

Discover more about diseases related to AMPK alpha 1 Antibody (NBP2-49430).

Pathways for AMPK alpha 1 Antibody (NBP2-49430)

View related products by pathway.

PTMs for AMPK alpha 1 Antibody (NBP2-49430)

Learn more about PTMs related to AMPK alpha 1 Antibody (NBP2-49430).

Research Areas for AMPK alpha 1 Antibody (NBP2-49430)

Find related products by research area.

Blogs on AMPK alpha 1.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AMPK alpha 1 Antibody and receive a gift card or discount.


Gene Symbol PRKAA1